Conserved Protein Domain Family
PRK14252

?
PRK14252: PRK14252 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172740
View PSSM: PRK14252
Aligned: 3 rows
Threshold Bit Score: 547.687
Threshold Setting Gi: 82702217
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30249004    1 MQIFKPAsGHTHSTVQKSVVNKLNFYYGGYQALKNIDMMVYEKQVTALIGPSGCGKSTFLRCFNRMHDLYPRNHYEGEII 80 
114330263   1 MQIFKLA-NAASPTTQKAAVNKLNFYYGGYQALKNINMVVHEKQVTALIGPSGCGKSTFLRCFNRMHDLYPHNHYEGEIL 79 
82702217    5 FSSQHPL-GDVSPSQYKSEVRNLSFYYGSFLALKNINMMLHEKKVTALIGPSGCGKSTFLRCFNRMHDLYPGNRYMGDII 83 
30249004   81 LHPDNANILSPEVDPIEVRMRISMVFQKPNPFPKSIFENVAYGLRIRGVKRRSILEERVENALRNAALWEEVKDRLGDLA 160
114330263  80 LYPDNENILSPEVDPIEVRMRISMVFQKPNPFPKSIFENVAYGLRIRGVKRRSILEERVENALRNAALWGEVKDRLGDLA 159
82702217   84 LHPDNVNILSRSVDPIEVRMRISMVFQKPNPFPKSIYENVAYGLRVRGVRRRAILDEKVEDALRGAALWDEVKDRLHQLA 163
30249004  161 FNLSGGQQQRLCIARALATDPEILLFDEPTSALDPIATASIEELISDLRNKVTILIVTHNMQQAARVSDYTAYMYMGELI 240
114330263 160 FNLSGGQQQRLCIARALATDPEILLFDEPTSALDPIATASIEELISDIKNKVTILIVTHNMQQAARVSDYTAYMYMGELI 239
82702217  164 YNLSGGQQQRLCIARALATDPEILLFDEPTSALDPIATASIEELIADLKDKVTILIVTHNMQQAARVSDYTAYMYLGEVI 243
30249004  241 EFGATDTIFIKPKNKQTEDYITGRFG 266
114330263 240 EFGATDNIFIKPKNKQTEDYITGRFG 265
82702217  244 EFGVTDTIFIKPKNKQTEDYITGRFG 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap