Conserved Protein Domain Family
PRK14251

?
PRK14251: PRK14251 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172739
View PSSM: PRK14251
Aligned: 6 rows
Threshold Bit Score: 524.211
Threshold Setting Gi: 268319130
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161506942   1 MTAIISAKDVHLSYGNYEALHGISLDFQEKELTALIGPSGCGKSTFLRCLNRMNDDIENIKITGEIKFEGQNIYSSKMDL 80 
58336703    1 MKTIISAKDVHLSYGDYEALHGINLNFKEKELTALIGPSGCGKSTFLRCLNRMNDDIENIKITGEIKFEGQDIYGSKMDL 80 
42518718    1 MENIITSKDVHLSYGNVEALHGISLDFEEKELTALIGPSGCGKSTFLRCLNRMNDDIPNIHISGEIKFENKNIYGPKMDL 80 
116629214  18 VENIITSRDVHLSYGNVEALHGISLDFEEKELTALIGPSGCGKSTFLRCLNRMNDDIPNIHISGDIQFEGQNIYGSKMDL 97 
268319130  30 VENIITSKDVYLSYGSVEALHGISLDFEEKELTALIGPSGCGKSTFLRCLNRMNDDIPNIHISGEIKFENKNIYGPKMDL 109
295692227   1 MTTIISAKDVHLSYGNYEALHGISLDFKKKELTALIGPSGCGKSTFLRCLNRMNDDIENIKITGEIKFEGQDIYNSKMDL 80 
161506942  81 VKLRKEVGMVFQQPTPFPFSVYDNVAYGLKIAGVKDKDLIDQRVEESLKQAAIWKETKDNLKRNAQAFSGGQQQRICIAR 160
58336703   81 VALRKNVGMVFQQPTPFPFSVYDNVAYGLKIAGVKDKELIDQRVEESLKQAAIWKETKDNLNRNAQAFSGGQQQRICIAR 160
42518718   81 VELRKDVGMVFQQPSPFPFSVYDNIAYGLRIAGIKDKELIDQRVEESLKQAAIWKETKDNLDRNAQAFSGGQQQRICIAR 160
116629214  98 VELRKEVGMVFQQPSPFPFSVYDNIAYGLKIAGIKDKELIDQRVEESLKQAAIWKETKDNLDRNAQAFSGGQQQRICIAR 177
268319130 110 VELRKDVGMVFQQPSPFPFSVYDNIAYGLRIVGIKDKELIDQRVEESLKQAAIWKETKDNLDRNAQAFSGGQQQRICIAR 189
295692227  81 VSLRKEVGMVFQQPTPFPFSVYDNVAYGLKIAGVKDKELIDQRVEESLKQAAIWKETKDNLTRNAQAFSGGQQQRICIAR 160
161506942 161 ALAVRPKVVLLDEPTSALDPISSSEIEETLMELKHQYTFIMVTHNLQQAGRISDQTAFLMNGDLVEAGPTEEMFIAPEKQ 240
58336703  161 ALAIRPKVVLLDEPTSALDPISSSEIEETLMDLKHQYTFIMVTHNLQQAGRVSDQTAFLMNGDLVEAGPTEEMFIAPKKQ 240
42518718  161 ALAVRPKVVLLDEPTSALDPISSSEIEETLLELKHDFTFIMVTHNLQQASRISDYTAFLMSGDLIEYGKTSDMFMNPKKQ 240
116629214 178 ALAVRPKVVLLDEPTSALDPISSSEIEETLLELKHEYTFIMVTHNLQQASRISDYTAFLMSGDLIEYGKTADMFMNPKKQ 257
268319130 190 ALAVRPKVVLLDEPTSALDPISSSEIEETLLELKHDFTFIMVTHNLQQASRISDYTAFLMSGDLIEYGKTSDMFMNPKKQ 269
295692227 161 ALAVRPKVVLLDEPTSALDPISSSEIEETLMELKHQYTFIMVTHNLQQAGRISDQTAFLMNGDLIEAGPTEEMFIAPKKQ 240
161506942 241 MTSDYLNGRFG 251
58336703  241 ITSDYLNGRFG 251
42518718  241 ITSDYLNGRFG 251
116629214 258 ITSDYLNGRFG 268
268319130 270 ITSDYLNGRFG 280
295692227 241 ITSDYLNGRFG 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap