Conserved Protein Domain Family
PRK14247

?
PRK14247: PRK14247 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172735
View PSSM: PRK14247
Aligned: 5 rows
Threshold Bit Score: 490.58
Threshold Setting Gi: 126460483
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
171185020   1 MSKIEARGLRVSFGQTQVIAGVDLSIPDRSITALMGPSGSGKSTLLRVFNRLIELYPEARVAGEAYLDGRDIFKMDVVEL 80 
18312609    1 MAKLTARDLKLSFGNVEVLKGVNLEIKERTITALMGPSGSGKSTLLRVFNRLIELYPEARVSGEVLLDGQDVFKMDVIEL 80 
119873016   1 MSKIETRGLRVSFGQTQVIVGVDLSIPDKSITALMGPSGSGKSTLLRVFNRLIELYPEAKVSGEVYLDGRDIFKMDVVEL 80 
145590693  19 QNKIVIKNLKVAFGSAEILRGVNLEIPPNTITALMGPSGSGKSTILRVLNRLIELYPEARVRGDVLLDGQSIFKMDVIEL 98 
126460483  29 RNVIDIRDLKLQFGDVKVLDGVTMKIPNNVIYVIMGPSGSGKSTILRVLNRLVELY-KPKIEGEVYLDGQDIFKMPLSLL 107
171185020  81 RRRVQMVFQIPNPIPNLSIFENVALGLKLNRLAKSRRELQERVRWALEKAQLWDEVKDRLGAPAGKLSGGQQQRLCMARA 160
18312609   81 RRRVQMIFQIPNPIPNLSIFENVALGLKLNRIVKSKKELEARVRQALEKAQLWDEVKNRLDAPAGKLSGGQQQRLCVARA 160
119873016  81 RRRVQMVFQIPNPIPNLSIFENVALGLKLNRLAKSKRELQERVRWALEKAQLWDEVRDRLGAPAGKLSGGQQQRLCIARA 160
145590693  99 RKRVQMIFQIPNPIPNLSIFENVALGLKLNRLVNNKKELFQRVKEALEKAQLWEEVKDRLNAPAGRLSGGQQQRLCVARA 178
126460483 108 RRRVQMVFQIPNPIPTLSIWENVALGPKLNRLVKSKAELQERVRWALEKAQLWEEVKNRLDAPAASLSGGQQQRLCIARA 187
171185020 161 LAFQPEVLLADEPTANLDPENTAKIEALFLELKKDMAIVMVTHFPQQAARISDYVAFLYRGQIVEWGATRDIFTNPKHEL 240
18312609  161 LAFDPEVLLADEPTANLDPENTAKLESLFLELKKDMTIVLVTHFPAQAARVSDYVAFLYKGQIVEVGPTKEVFTNPRHEL 240
119873016 161 LAFQPEVLLADEPTANLDPENTAKIEALFLELKKDMAIVMVTHFPQQAARISDYVAFLYKGQIVEWGATRDIFTKPRHQL 240
145590693 179 LAFNPEVLLADEPTANLDPENTAKIESLFLELKKEMTIILVTHFPGQAARISDYVAFLYKGQIVETGPTKEVFTNPKHEL 258
126460483 188 LAFKPEVLLMDEPTANLDPVNTAKIEELMLELKKEMTIVLVTHYPPQAARVGDWVAFLYGGKIVEEGPVREVFTRPRHEL 267
171185020 241 TERYVTGRLY 250
18312609  241 TEKYVTGKLY 250
119873016 241 TEKYVTGRLY 250
145590693 259 TEKYVTGRLY 268
126460483 268 TEKYVTGKI- 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap