Conserved Protein Domain Family
PRK14246

?
PRK14246: PRK14246 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172734
View PSSM: PRK14246
Aligned: 8 rows
Threshold Bit Score: 490.714
Threshold Setting Gi: 284998133
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15897414    1 MEAGKSAEDVFNISRLYLYINDKAILKDITIKIPNNSIFGIMGPSGSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
227830606   1 MEAGKSAEDVFNISRLYLYINDKAILKDITIKIPNNSIFGIMGPSGSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
227827884   1 MEAGKSAEDVFNISRLYLYINDKAILRDITIKIPNNSIFGIMGPSGSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
229585151   1 MEAGKSAEDVFNISRLYLYINDKAILRDITIKIPNNSIFGIMGPSGSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
229579489   1 MEAGKSAEDVFNISRLYLYINDKAILKDITIKIPNNSIFGIMGPSGSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
229581823   1 MEAGKSAEDVFNISRLYLYIDDKAILKNITVKIPNNSIFGIMGPSGSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
238620110   1 MEAGKSAEDVFNISRLYLYINDKAILRDITIKIPNNSIFGIMGPSGSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
284998133   1 MEAGKSAEDVFNISRLYLYINDKAILKDITIKIPNNSIFGIMGPSSSGKSTLLKVLNRLIEIYDSKIKVDGKVLYFGKDI 80 
15897414   81 FQIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQ 160
227830606  81 FQIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQ 160
227827884  81 FRIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQ 160
229585151  81 FRIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQ 160
229579489  81 FQIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQ 160
229581823  81 FQIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKDKREIKKIMEESLRKVGLWKEVHDRLNSPASQLSGGQQQ 160
238620110  81 FQIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQ 160
284998133  81 FQIDAIKLRKEVGMVFQQPNPFPHLSIYDNIAYPLKSHGIKEKREIKKIVEECLRKVGLWKEVYDRLNSPASQLSGGQQQ 160
15897414  161 RLTIARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYVAFLYNGELVEWGSSNEIF 240
227830606 161 RLTIARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYVAFLYNGELVEWGSSNEIF 240
227827884 161 RLTIARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYVAFLYNGELVEWGSSNEIF 240
229585151 161 RLTIARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYVAFLYNGELVEWGSSNEIF 240
229579489 161 RLTIARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYVAFLYNGELVEWGSSNEIF 240
229581823 161 RLTIARALALKPKVLLMDEPTSMIDVVSSQDIEKLITELKKEMTIVLVSHNPQQAARVADYVAFLYNGELVECGSSNEIF 240
238620110 161 RLTIARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYVAFLYNGELVEWGSSNEIF 240
284998133 161 RLTIARALALKPKVLLMDEPTSMIDIVNSQAIEKLITELKNEIAIVIVSHNPQQVARVADYVAFLYNGELVEWGSSNEIF 240
15897414  241 TSPKNELTEKYVIGRIS 257
227830606 241 TSPKNELTEKYVIGRIS 257
227827884 241 TSPKNELTEKYVIGRIS 257
229585151 241 TSPKNELTEKYVIGRIS 257
229579489 241 TSPKNELTEKYVIGRIS 257
229581823 241 TSPKNELTEKYVIGRIS 257
238620110 241 TSPKNELTEKYVIGRIS 257
284998133 241 TSPKNELTEKYVIGRIS 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap