Conserved Protein Domain Family
PRK14245

?
PRK14245: PRK14245 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172733
View PSSM: PRK14245
Aligned: 5 rows
Threshold Bit Score: 530.746
Threshold Setting Gi: 150009024
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150006418   1 MNKIDAKHVNFFYGDFQALKDISMTIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPGSRLEGEILIDGRNIYDKSVQVD 80 
150009024   1 MIKIDAKNVDFYYGDFHALKNISMEIEPNTSTAFIGPSGCGKSTFLRLFNRMNDLIPDTRMEGQILIDGRDIYTKSERVD 80 
29346731    3 TVKIDTRDVNFWYGDFHALKGISMQIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPATRLEGEIRIDGHNIYAKGVEVD 82 
53714046    4 TVKIDARDVNFWYGDFHALKGISMEIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPATRLTGEIRIDGENIYDKGVQVD 83 
60682241    4 TVKIDARDVNFWYGDFHALKGISMEIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPATRLTGEIRIDGENIYDKGVQVD 83 
150006418  81 ELRKSVGMVFQRPNPFPKSIFENVAYGLRVNGVKDNEFIRHRVEETLKGAALWDEVKNKLKESAFALSGGQQQRLCIARA 160
150009024  81 RLRKNVGMVFQKPNPFPKTIYENVAYGLRVNGVNDENYIEETVVKTLKQVVLWDEVKDKLKESAFALSGGQQQRLCIARA 160
29346731   83 ELRKNVGMVFQRPNPFPKSIFENVAYGLRVNGVKDNAFIRQRVEETLKGAALWDEVKDKLKESAYALSGGQQQRLCIARA 162
53714046   84 ELRKNVGMVFQRPNPFPKSIFENVAYGLRVNGVKDNAFIRQRVEETLKGAALWDEVKDKLKESAFALSGGQQQRLCIARA 163
60682241   84 ELRKNVGMVFQRPNPFPKSIFENVAYGLRVNGVKDNAFIRQRVEETLKGAALWDEVKDKLKESAFALSGGQQQRLCIARA 163
150006418 161 MAVSPSVLLMDEPASALDPISTAKVEELIHELKKEYTIVIVTHNMQQAARVSDKTAFFYMGNMVEYDDTKKIFTNPGKEA 240
150009024 161 LAISPSILLMDEPTSALDPISTSKIEDLIHELKNDYTIVIVTHNMQQAARVSDKTGYFYLGELIEYDNTRKIFTNPEKES 240
29346731  163 MAVSPSVLLMDEPASALDPISTAKVEELIHELKKDYTIVIVTHNMQQAARVSDKTAFFYLGEMVEYDDTKKIFTNPEKEA 242
53714046  164 MAVSPSVLLMDEPASALDPISTAKVEELIHELKERYTIVIVTHNMQQAARVSDKTAFFYMGQMVEFGDTKKIFTNPEKEA 243
60682241  164 MAVSPSVLLMDEPASALDPISTAKVEELIHELKERYTIVIVTHNMQQAARVSDKTAFFYMGQMVEFGDTKKIFTNPEKEA 243
150006418 241 TQNYITGRFG 250
150009024 241 TQNYITGRFG 250
29346731  243 TQNYITGRFG 252
53714046  244 TQNYITGRFG 253
60682241  244 TQNYITGRFG 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap