Conserved Protein Domain Family
PRK14244

?
PRK14244: PRK14244 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172732
View PSSM: PRK14244
Aligned: 13 rows
Threshold Bit Score: 505.134
Threshold Setting Gi: 88607110
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190570575   1 MNDKYAFVKNLNLWYGSKQVLFDINLNICKKKVTTFIGPSGCGKSTFLRCFNRMNDYVPGCKATGELVIDGLgNIYSRDM 80 
222475333  23 VSEVHAAVEGLNLWYGKKQILFDVNLDVYKREVTALIGPSGCGKSTFLRCFNRMNDFVPDCKVEGKIDIEGM-DVHSPDT 101
225630213   1 MSNTRASVKDLNLWYGSKQVLFDINLNIYKRKVTTFIGPSGCGKSTFLRCFNRMNDYVPGCKTVGELDIDGLgDIYSRDM 80 
57239303    2 SIEIHASAKNLNLWYDSNQVLHNISLDIYKREVTAFIGPSGCGKSTFLRCFNRMNDFVSNCKIKGELIIENI-DVCSVNT 80 
58579269    2 SIEIHASAKNLNLWYDSNQVLHNISLDIYKREVTAFIGPSGCGKSTFLRCFNRMNDFVSNCKIKGELIIENI-DVCSVNT 80 
58584438    1 MNNTHASVKNLSLWYGSKQALFDINLDICKKKVTAFIGPSGCGKSTFLRCFNRMNDYVPGCKVAGKLDIDGLgDIYSRNV 80 
58617323    2 SIEIHASAKNLNLWYDSNQVLHNISLDIYKREVTAFIGPSGCGKSTFLRCFNRMNDFVSNCKIKGELIIENI-DVCSVNT 80 
56416967   23 VSEVHAAVEGLNLWYGKKQILFDVNLDVYKREVTALIGPSGCGKSTFLRCFNRMNDFVPDCKVEGKIDIEGM-DVHSPDT 101
42520251    1 MSNTRASVKDLNLWYGSKQVLFDINLNIYKRKVTTFIGPSGCGKSTFLRCFNRMNDYVPGCKTVGELDIDGLgDIYSRDM 80 
88657871    2 SQRIHASARNLSLWYDTNQILYDINLDVYKREVTAFIGPSGCGKSTFLRCFNRMNDFISNCKIKGSLNVDDI-GVYSVNT 80 
88607110    1 MQDVHAVVKDLNLWYEGKQILFDVNLNVCKREITTLIGPSGCGKSTFLRCFNRMNDFVPNCKVDGKIIVDGM-DVFSDAT 79 
73667194    2 SQQIHASARNLSLWYDTNQILHDINLDIYKREVTAFIGPSGCGKSTFLRCFNRMNDFISNCKIKGSLNVDDI-CIYSVNT 80 
269958619   1 MSEVHAAVEGLNLWYGKKQILFDVNLDVYKREVTALIGPSGCGKSTFLRCFNRMNDFVPDCKVEGKIDIEGM-DVHSPDT 79 
190570575  81 DVVLLRAKVGMVFQKPNPFPKSIYDNVAYGPKLHGMVKNKQKLDEIVESSLTKVGLWEELKDRLQDSALNLSGGQQQRLC 160
222475333 102 NVVLLRAKVGMVFQKPNPFPDSIYKNIAYGPKLHGLARNKRRLDDIVEESLRRVGLWDELGGRLKDSACKLSGGQQQRLC 181
225630213  81 DVVLLRAKVGMVFQKPNPFPKSIYDNVACGPKLHGMAKDKQKLNEMVENSLTKVGLWEELKDRLQDSALNLSGGQQQRLC 160
57239303   81 NVVLLRAKVGMVFQKPNPFPKSIYDNVAYGPKLHGLAKNKKKLDEIVEKSLTSVGLWEELSDRLKDNAFELSGGQQQRLC 160
58579269   81 NVVLLRAKVGMVFQKPNPFPKSIYDNVAYGPKLHGLAKNKKKLDEIVEKSLTSVGLWEELSDRLKDNAFELSGGQQQRLC 160
58584438   81 DVVLLRAKVGMVFQKPNPFPKSIYDNVAYGPKLHGMVKNKQKLDEIVENSLTKVGLWEELKDRLQDSALDLSGGQQQRLC 160
58617323   81 NVVLLRAKVGMVFQKPNPFPKSIYDNVAYGPKLHGLAKNKKKLDEIVEKSLTSVGLWEELSDRLKDNAFELSGGQQQRLC 160
56416967  102 NVVLLRAKVGMVFQKPNPFPDSIYKNIAYGPKLHGLARNKRRLDDIVEESLRRVGLWDELGGRLKDSACKLSGGQQQRLC 181
42520251   81 DVVLLRAKVGMVFQKPNPFPKSIYDNVACGPKLHGMAKDKQKLNEMVENSLTKVGLWEELKDRLQDSALNLSGGQQQRLC 160
88657871   81 NVVLLRAKVGMVFQKPNPFPKSIYDNVAYGPKLHGLAKNKKKLDEIVEKSLTSVGLWEELCDRLKDNAFELSGGQQQRLC 160
88607110   80 DVVLLRAKVGMVFQKPNPFPKSIYDNIAYGPKLHGLARSKKKLDSIVEDSLRSVGLWEELGGRLRDNACKLSGGQQQRLC 159
73667194   81 NVVLLRAKVGMVFQKPNPFPKSIYDNVAYGPKLHGLAKNKKKLDEIVERSLTSVGLWEELCDRLKDNAFELSGGQQQRLC 160
269958619  80 NVVLLRAKVGMVFQKPNPFPDSIYKNIAYGPKLHGLARNKRRLDDIVEESLRRVGLWDELGGRLKDSACKLSGGQQQRLC 159
190570575 161 IARAIAVKPTILLMDEPCSALDPMATNAIENLIQELKLRFTIIMVTHSMKQAKKLSDSIVFFCNGKIVEFGSTQEIFENA 240
222475333 182 IARAIAVRPTMLLMDEPCSALDPVATGVVENLIKELKKNFTIVLVTHSVKQVREVSDRVAFFQEGRIVEHNTTKEVFKAP 261
225630213 161 IARAIAVKPTILLMDEPCSALDPMATNAIENLIQELKLRFTIIMVTHSMKQAKKLSDSVIFFHNGRIVESGSTQEIFENA 240
57239303  161 IARAIAVKPTMLLMDEPCSALDPFATSVIENLIQNLKKNFTIIVVTHSMKQARKVSDKVAFFESGKLIEYNTTDEIFKNP 240
58579269  161 IARAIAVKPTMLLMDEPCSALDPFATSVIENLIQNLKKNFTIIVVTHSMKQARKVSDKVAFFESGKLIEYNTTDEIFKNP 240
58584438  161 ISRAIAVKPTILLMDEPCSALDPMATNAIENLIQELKLRFTIIMVTHSMKQAKKLSDSIIFFCNGKIVESGSVQEIFENA 240
58617323  161 IARAIAVKPTMLLMDEPCSALDPFATSVIENLIQNLKKNFTIIVVTHSMKQARKVSDKVAFFESGKLIEYNTTDEIFKNP 240
56416967  182 IARAIAVRPTMLLMDEPCSALDPVATGVVENLIKELKKNFTIVLVTHSVKQVREVSDRVAFFQEGRIVEHNTTKEVFKAP 261
42520251  161 IARAIAVKPTILLMDEPCSALDPMATNAIENLIQELKLRFTIIMVTHSMKQAKKLSDSVIFFHNGRIVESGSTQEIFENA 240
88657871  161 IARAIAVRPTMLLMDEPCSALDPVATNVIENLIQNLKKNFTIIVVTHSMKQAKKISDRVAVFDSGRIVEYNTTQEIFQNP 240
88607110  160 IARAIAVRPTMLLMDEPCSALDPVATGVVENLIRDLKKNFAIVVVTHSIKQVKKISDKVIFFSGGRVVEQGATQEVFQNP 239
73667194  161 IARAIAVRPTMLLMDEPCSALDPVATNVIENLIQNLKKHFTIIVVTHSMKQAKKISDRVAVFDSGRIVEYNTTQEIFENP 240
269958619 160 IARAIAVRPTMLLMDEPCSALDPVATGVVENLIKELKKNFTIVLVTHSVKQVREVSDRVAFFQEGRIVEHNTTKEVFKAP 239
190570575 241 QSPLTKEYILDH 252
222475333 262 KSEEVKGYLADH 273
225630213 241 QSPLTKEYILDH 252
57239303  241 QSSKTKRYIVDH 252
58579269  241 QSSKTKRYIVDH 252
58584438  241 RSPLTKEYILDH 252
58617323  241 QSSKTKRYIVDH 252
56416967  262 KSEEVKGYLADH 273
42520251  241 QSLLTKEYILDH 252
88657871  241 QSSKTQRYIVDQ 252
88607110  240 KSDVVKGYLEEH 251
73667194  241 QSSKTQRYIVDQ 252
269958619 240 KSEEVKGYLADH 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap