Conserved Protein Domain Family
PRK14242

?
PRK14242: PRK14242 
phosphate ABC transporter ATP-binding protein
Statistics
?
PSSM-Id: 172730
View PSSM: PRK14242
Aligned: 13 rows
Threshold Bit Score: 507.396
Threshold Setting Gi: 108758458
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224367368   1 MDHPIKMYAKGLDFFYSGSQALYNISLEFPEKRVTALIGPSGCGKSTFLRCLNRMNDLIPGTRSRGEILLEGMNISDPTL 80 
220919224  10 AAPVPKMEARHLSVRYGEKLAVKDISLALPERQVTALIGPSGCGKSTFLRALNRMNDLIPGARAEGEILLDGASVFDRHI 89 
218779280   1 MTEPMKVSSKNLDFFYGPSQALYDVNLDFEQNKVTALIGPSGCGKSTFLRCINRMNDLIPIARVQGDLRIDDVDIYSPEV 80 
218885984   3 DSKNVKMHAASLNFYYGDFQALHDINLEFERNQVTALIGPSGCGKSTFLRCLNRMNDLIPISRVDGEICLDGMNIHDPRL 82 
197124500  10 AAPVPKMEARHLSVRYGEKPAVKDISLALPDRQVTALIGPSGCGKSTFLRALNRMNDLIPGARADGEILLDGESVFDRHI 89 
158521939   1 --MPIKMSANHLSFFYGDFEALSDITLDFEQNQVTALIGPSGCGKSTFLRCLNRMNDLIPGTRVEGEITLDGQPVYGSRV 78 
46579497    3 VTSKAKMYAQGLQFYYGDFKALHDIDLTFEQNQVTALIGPSGCGKSTFLRCLNRMNDLIPISRVEGVIALDGENIYDPKV 82 
86160419   10 AAPVPKMEARHLSVRYGEKLAVKDISLALPERQVTALIGPSGCGKSTFLRALNRMNDLIPGARAEGEILLDGESVFDRHI 89 
78357429    1 MASLTKMHSKGLDFFYGDFQALHDISLEFSNNQVTALIGPSGCGKSTFLRCLNRMNDLIPISRVEGEICLDNDNIYDPQV 80 
116750315   1 -MSMLKMASTKLNFFYGGFQALSDISLEFERNRVTALIGPSGCGKSTFLRCLNRMNDLIPGTRVEGTILLDGEDIYASEM 79 
108758458   1 ------MEARELSLRYGPKTAIHKVSLAILDRRVTALIGPSGCGKSTFLRSLNRMNDLISGTTHSGTILLDGTDIHDRGV 74 
153003295   8 LPAAVKMETRGLEIRYGAKLAVKGVSLSLPEHQVTALIGPSGCGKSTFLRALNRMNDLIPGASAAGEILLDGRSIYAAHL 87 
120602953   4 VTSKAKMYAQGLQFYYGDFKALHDIDLTFEQNQVTALIGPSGCGKSTFLRCLNRMNDLIPISRVEGVIALDGENIYDPKV 83 
224367368  81 DVVSLRRRVGMVFQKPNPFPKTIFENIAYGMRVNGIKDKALIAERVETSLKQAAIWDEVKERLNESALGLSGGQQQRLCI 160
220919224  90 DAVELRRRVGMVFQKSNPFPKSIFENVAYGLRVSGLKDRAALAERVERSLVNAALWDEVKDRLGESALGLSGGQQQRLCI 169
218779280  81 DVVDLRSRVGMVFQKPNPFPKTIFENVAYGLRVKGVRNKAYIASQVEKSLESAALFDEVKDRLHDSALGLSGGQQQRLCI 160
218885984  83 DVVELRRRVGMVFQKPNPFPKSIFENVAYGLRVNGVRDKEYIAEKVEQSLRHAALWDEVKDRLHESGLGLSGGQQQRLCI 162
197124500  90 DAVELRRRVGMVFQKSNPFPKSIFENVAYGLRVGGMKDRAALAERVERSLVNAALWDEVKDRLGESALGLSGGQQQRLCI 169
158521939  79 DVVNLRRMVGMVFQKPNPFPKTIFENIAYGLRINGVKDKSLIANKVEESLKQAALWEEVKDRLSASALGLSGGQQQRLCI 158
46579497   83 DVVELRRRVGMVFQKPNPFPKTVFENVAYGLRVNGVKDREYLEEKVEQSLRHAALWDEVKDRLQDSALGLSGGQQQRLCI 162
86160419   90 DAVELRRRVGMVFQKSNPFPKSIFENVAYGLRVSGLKDRAALAERVERSLVNAALWDEVKDRLGESALGLSGGQQQRLCI 169
78357429   81 DVVELRRRVGMVFQKPNPFPKSIYENVAYGLRVNGVKDKNCLEDKVEESLRHAALWDEVKDRLHDSALGLSGGQQQRLCI 160
116750315  80 DVVTLRRRVGMVFQKPNPFPKTVFENVAYGLRVNAVRDETFIAERVEKSLRRAALWEEVKERLHQSALGLSGGQQQRLCI 159
108758458  75 DVVDLRRRVGMVFQKSNPFPKSIFENVAYGLRVGGMKDKAELATRVEKSLRGAALWDEVKDRLDESALGLSGGQQQRLCI 154
153003295  88 DAVELRRRVGMVFQKSNPFPKSIFENVAYGLRVGGLGDRRELAERIERSLRSAALWDEVKDRLAESAMGLSGGQQQRLCI 167
120602953  84 DVVELRRRVGMVFQKPNPFPKTVFENVAYGLRVNGVKDREYLEEKVEQSLRHAALWDEVKDRLQDSALGLSGGQQQRLCI 163
224367368 161 ARALAVQPEVLLMDEPASALDPIATQKIEELIISLSQHLTIIIVTHNMQQAARVSDITAFFYMGKLIEVNNTDALFTKPE 240
220919224 170 ARALAVEPEVVLMDEPASALDPIATAKIEDLIHHLKARYTIAIVTHNMQQAARVSDQTAFFYMGDLVEVGPTEQIFTNPR 249
218779280 161 ARALAVEPEVLLMDEPASALDPVATQKIEELILQLKTTYTIIIVTHNMQQAARVSDVTAFFFMGKLIEADATETLFTKPR 240
218885984 163 ARALAVEPEVLLMDEPASALDPIATQKIEELIHILKKDYTIIIVTHSMQQAARVSDLTAFFYMGKLVEWGATEMMFTRPR 242
197124500 170 ARALAVEPEVLLMDEPASALDPIATAKIEDLIHQLKARYTIAIVTHNMQQAARVSDQTAFFYMGDLVEVGPTEQIFTNPR 249
158521939 159 ARALAVEPEVLLMDEPASALDPIATQKIEELIHLLKASYTIIIVTHNMQQAARVSDTTAFFYIGKLIETGETDVIFTRPE 238
46579497  163 ARALAVEPEVLLMDEPASALDPIATQKIEELIHILKQQYTIIIVTHSMQQAARVSDVTAFFYMGRLIETGATEIMFTRPR 242
86160419  170 ARALAVEPEVVLMDEPASALDPIATAKIEDLIHHLKARYTIAIVTHNMQQAARVSDQTAFFYMGDLVEVGPTEQIFTNPS 249
78357429  161 ARALAVEPEVLLMDEPASALDPIATQKIEELIHTLKQKYTIIIVTHSMQQAARVSDVTAFFYMGRLIETGDTEVMFTRPG 240
116750315 160 ARALAVEPEVLLMDEPASALDPIATQKIEELIQELKKNYTIIIVTHNMQQAARVSDVTAFFYMGALIEVNTTETLFTRPK 239
108758458 155 ARAMAVEPEVLLMDEPASALDPIATAKIEELIHELKSTYTIAIVTHNMQQAARVSDRTAFFYMGELVECGPTEQIFTNPR 234
153003295 168 ARALAVEPEVLLMDEPASALDPIATAKIEDLIHELKARYTIAIVTHNMQQAARVSDQTAFFYMGELVEVGPTEAIFTNPR 247
120602953 164 ARALAVEPEVLLMDEPASALDPIATQKIEELIHILKQQYTIIIVTHSMQQAARVSDVTAFFYMGRLIETGATEIMFTRPR 243
224367368 241 LKQTEEYITGRFG 253
220919224 250 EQRTEDYVTGKFG 262
218779280 241 KQQTSDYITGRFG 253
218885984 243 NKQTEDYITGRFG 255
197124500 250 EQRTEDYVTGKFG 262
158521939 239 KKQTEDYITGRFG 251
46579497  243 NKQTEDYITGRFG 255
86160419  250 EQRTEDYVTGKFG 262
78357429  241 NKQTEDYITGRFG 253
116750315 240 YRQTEDYVTGRFG 252
108758458 235 EKRTEDYVTGKFG 247
153003295 248 EQRTEDYVTGKFG 260
120602953 244 NKQTEDYITGRFG 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap