Conserved Protein Domain Family
PRK14234

?
PRK14234: PRK14234 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172722
View PSSM: PRK14234
Aligned: 13 rows
Threshold Bit Score: 153.776
Threshold Setting Gi: 146307408
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226944893   1 MIGVTLAVAVGGALGCLLRFATSNWISAHWPQHFYAATLAVNIAGCLLIGYLYGQFLLRPEVPLALRAGLIAGFLGGLTT 80 
229591233   1 MFKTILAVSAAGIAGTLLRFAAGTWVSANWPKHFYAATLAVNLVGCLIIGLLYGWFLLRPEVPIEIRAGLIVGFVGGLTT 80 
167034602   1 MIALIAAVSAGGVAGTLLRFATANWVAAHWPRHFYAGTLAVNLVGCLLIGLLYGLFLHKPLAPIELRAGLIVGFLGGLTT 80 
66046405    1 MIQTILAVSIAGIAGTLLRFATGTWVSANWPRYFYAATLAVNIVGCLIIGVLYGLFLLRPEVPIEIRAGLIVGFVGGLTT 80 
26990706    1 MIALIAAVSAGGIAGTLLRFATTNWVAAHWPRHFYAGTLAVNLVGCLLIGLLYGLFLHKPLAPVELRAGLIVGFLGGLTT 80 
28870510    1 MIQTILAVSIAGIAGTLLRFAAGTWVSANWPRYFYAATLAVNIVGCLIIGVLYGLFLSRPEVPVEIRAGLIVGFVGGLTT 80 
77459805    1 MVPLIVAVSVGGIAGTLLRFATGNWVNANWPRHFYTATLAVNIVGCLLIGVLYGLFLIRPEVPIEVRAGLMVGFLGGLTT 80 
70731236    1 MIPLILAVSAGGVAGTLLRFATGNWINANWPRHFYTATLAVNIVGCLLIGVLYGLFLVRPEVPIEVRAGLIVGFLGGLTT 80 
71736065    1 MIQTILAVSIAGIAGTLLRFAAGTWVSANWPRHFYAATLAVNIVGCLIIGVLYGLFLLRPEVPIEIRAGLIVGFVGGLTT 80 
104781340   1 MIALIAAVSAGGIAGTLLRFATANWVAAHWPRHFYAGTLAVNLVGCLLIGLLYGLFLHKPLAPVELRAGLIVGFLGGLTT 80 
148547067   1 MIALIAAVSAGGIAGTLLRFATTNWVAAHWPRHFYAGTLAVNLVGCLLIGLLYGLFLHKPLAPVELRAGLIVGFLGGLTT 80 
146307408   2 MIRVALAVAAGGAAGSVMRFLLASWVAANWPRHFYLGTFAANIIGCLLIGLLSGLFLARSDLPLELRTGLITGVLGGFTT 81 
146282638   1 MIRMAFAVACGGVIGTLLRFALATWVSAQWPRHFYLATVAVNLLGCLLIGYLYATFLARPDISPELRGALIIGFLGALTT 80 
226944893  81 FSSFSLDTLRLLESGQAPLAFSYLAFSVLGGLLATWAGLILTKL 124
229591233  81 FSSFSLDTLRLLESGQALIAFGYLGISVFGGLLATWAGLSLTKL 124
167034602  81 FSSFSLDTVRLMESGQVPLALGYTSISVVGGLLATWAGLSLTRF 124
66046405   81 FSSFSLDTLRLLESGQVPLALGYAGISVFGGLLATWAGLSLTRL 124
26990706   81 FSSFSLDTVRLMESGQVPLALGYTSISVVGGLLATWAGLSLTRF 124
28870510   81 FSSFSLDTLRLLESGQVPLALGYAGISVFGGLLATWAGLSLTRL 124
77459805   81 FSSFSLDTVRLLESGQVPLALGYAAISVFGGLLATWAGLSLTKL 124
70731236   81 FSSFSLDTVRLLESGQVALALGYAALSVFGGLLATWAGLSLTKL 124
71736065   81 FSSFSLDTLRLLESGQVPLALGYAGISVFGGLLATWVGLSLTRL 124
104781340  81 FSSFSLDTVRLMESGQVPLAMGYTIISVVGGLLATWAGLSLTRF 124
148547067  81 FSSFSLDTVRLMESGQVPLALGYTSISVVGGLLATWAGLSLTRF 124
146307408  82 FSSFSLEIIKLMEGGRAVEAFGYLAFSILGGLLAAWAGLTLARL 125
146282638  81 FSSFSLDALRLLESGQLATAFAYVGGSVLGGLLAAWAGLALARL 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap