Conserved Protein Domain Family
PRK14233

?
PRK14233: PRK14233 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172721
View PSSM: PRK14233
Aligned: 12 rows
Threshold Bit Score: 165.055
Threshold Setting Gi: 192289932
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148558430   2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGY 81 
86747328    1 MLDTCLLVGLGGAVGGASRFVVSDIVGQRWGTTFPWGTLVVNVTGALLIGIVVGLARIDAGAFNSPRLHDLIITGLLGGY 80 
83269329    2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGY 81 
23500547    2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGAIFSTTIFHEFIMVGLLGGY 81 
62317352    2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGY 81 
192289932   2 TLEACLLVGVGGAIGGASRFVVSDAVGLRWGTTFPWGTLVVNVTGALLIGVFVGCARVYAGAFDSLLTRDLIITGVLGGY 81 
189022602   2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGY 81 
161620875   2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGAIFSTTIFHEFIMVGLLGGY 81 
161511174   2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGY 81 
163844938   2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGAIFSTTIFHEFIMVGLLGGY 81 
225686580   2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGY 81 
256015582   2 SVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGY 81 
148558430  82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
86747328   81 TTVSSFSLQTVNLVLDRRAGLATLNVVASTTLCLTAVAFGYFGTIWAARHGA 132
83269329   82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
23500547   82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
62317352   82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
192289932  82 TTVSSFSLQTINLVLDRRAGIAVLNVIASTTLCLIAVALGYFGTISAAGGGA 133
189022602  82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
161620875  82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
161511174  82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
163844938  82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
225686580  82 ATVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
256015582  82 TTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap