Conserved Protein Domain Family
PRK14230

?
PRK14230: PRK14230 
camphor resistance protein CrcB; Provisional
Statistics
?
PSSM-Id: 172718
View PSSM: PRK14230
Aligned: 7 rows
Threshold Bit Score: 164.474
Threshold Setting Gi: 194098515
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218768127   1 MLSNIIPLSIGAALGATARWLLNLAVPASLSPATGNLFANWTGAFLIGIFAETVNHPQWKLLLITGFLGSLTTLSGFSLE 80 
161869950   1 MLSNIIPLSIGAALGATARWLLNLAVPAAMSPATGNLFANWTGALLIGIFAETVNHPQWKLLLITGFLGSLTTLSGFSLE 80 
194098515   1 MLSNILPLSIGAIFGTTARWLLNLAVPASLSPATGNLFANWTGALLIGIFAETVSHPQWKLLLITGFFGSLTTLSGFSLE 80 
15676949    1 MLSNIIPLSIGAALGATARWLLNLAVPASIPPATGNLFANWIGAFLIGIFAETVNHPQWKLLLITGFLGSLTTLSGFSLE 80 
59801257    1 MLSNILPLSIGAIFGTTARWLLNLAVPASLSPATGNLFANWTGALLIGIFAETVSHPQWKLLLITGFFGSLTTLSGFSLE 80 
121634835   1 MLSNIIPLSIGAALGATARWLLNLAVPAAMSPATGNLFANWTGALLIGIFAETINHPQWKLLLITGFLGSLTTLSGFSLE 80 
254804942   1 MLSNIIPLSIGAAFGATARWLLNLAVPASIPPATGNLFANWIGAFLIGIFAETVNHPQWKLLLITGFLGSLTTLSGFSLE 80 
218768127  81 TVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGTAVK 119
161869950  81 TVTLLQSNRPASALSNIFLHTAGSLLLTWLGLKIGTAVK 119
194098515  81 TVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGTAVK 119
15676949   81 TVTLLQLNRPASALANIFLHTAGSLLLTWLGLKIGAAVK 119
59801257   81 TVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGTAVK 119
121634835  81 TVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGAAVK 119
254804942  81 TVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGAAVK 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap