Conserved Protein Domain Family
PRK14229

?
PRK14229: PRK14229 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172717
View PSSM: PRK14229
Aligned: 15 rows
Threshold Bit Score: 148.447
Threshold Setting Gi: 225859089
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157150545   1 MIWLMITACGGGALVRYFLSKVNSRAVLPVGTLMANLLGAFLIGYFYNHIQDKQLYTILVTGFCGGLTTLSTFNAELVGL 80 
116515926   2 VIVYLAIACGFGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
15903215    2 VIVYLAIACGFGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
169833753   2 VIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
221231981   2 VIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
225854758   2 VIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
225856956   2 VIVYLAIACGLGALVRYFFSRYNQVSKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
225859089   2 VIVYLAIACGLGALVRYFFSRYNQASKLPFGTLIANLLGCFLIGLFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
225860875   2 VIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
289168106   2 VMVYLAIACGFGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGLFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRL 81 
157150545  81 FSNKKKFIHYLILTYCLGFLAIILGIFI 108
116515926  82 LSDKKVFYSYLILTYLGGLVAIFLGILL 109
15903215   82 LSDKKVFYSYLILTYLGGLVAIFLGILL 109
169833753  82 LSDKKVFYSYLTLTYIGGLVAIFLGILL 109
221231981  82 LSDKKVFYSYLTLTYIGGLVAIFLGILL 109
225854758  82 LSDKKVFYSYLTLTYIGGLVAIFLGILL 109
225856956  82 LSDKKVFYSYLTLTYIGGLVAIFLGILL 109
225859089  82 LSDKKVFYSYLALTYLGGLVAIFLGILL 109
225860875  82 LSDKKVFYSYLTLTYIGGLVAIFLGILL 109
289168106  82 LSDKKVFYSYLALTYLGGLVAIFLGILL 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap