Conserved Protein Domain Family
PRK14227

?
PRK14227: PRK14227 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172715
View PSSM: PRK14227
Aligned: 3 rows
Threshold Bit Score: 170.403
Threshold Setting Gi: 225849831
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188996945   1 MEKYLVIAVGGSIGAILRYLTGVYSAKFFGTWLPYGTLIVNVVGSFILSFFMILFLEKLSLDPLWRLFVAVGFCGSYTTL 80 
225849304   1 MDKYIVLAIGGAIGTILRYITGVYSAKILGSDFPYGTLIVNTVGSFILSFFMILFLEKLSLDPLWRLFVAVGFCGSFTTM 80 
225849831   1 -MEYIYVMIGGSLGAVSRFFISNYVNRNLPLDFPAGTLVVNSLGSFILVFFLILSIEKLSIDPVWRLFFAVGFLGAFTTF 79 
188996945  81 SSITYETLSIVMDGDYVRALLNIALNFGLSFLSAFAGIVLARML 124
225849304  81 SSFTYETFALLIDGDYIKAGLNVILNLTLSLTSAFLGIVFARSL 124
225849831  80 STFSYETIALFQDGEYTKAMLNIILNNVVSITAGISGLFLARVI 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap