Conserved Protein Domain Family
PRK14226

?
PRK14226: PRK14226 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172714
View PSSM: PRK14226
Aligned: 9 rows
Threshold Bit Score: 145.406
Threshold Setting Gi: 167626912
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
187932193   1 MG-LLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSAYVRFLLVTGFLG 79 
167626912   1 MG-LLLILVGIGGGLGAMSRFALTQATASISKQIPIGILLCNIIGSLIIGMMAAFLIQTKLFNEDISTYVRSLFVTGFLG 79 
156501521   1 MG-LLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLG 79 
134302638   1 MGlLLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLG 80 
118496751   1 -----------------MARFALTQATASISKQIPLGILLCNVIGSLIIGMMAAFLIETKLFNEDVSTYVRSLLVTGFLG 63 
89255578    1 MG-LLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLG 79 
110669887   1 MG-LLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLG 79 
115314084   1 MG-LLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLG 79 
56707416    1 MG-LLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKLFNEDVSTYVRFLLVTGFLG 79 
187932193  80 GFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVILGFYIVMGVYK 130
167626912  80 GFTTFSSFSLDILNLLQRGEALLAISYILVSVIVSLIAVILGFYFIMGIYR 130
156501521  80 GFTTFSSFSLDILNLLQRGEIFIAIGYIWLVS------------------- 111
134302638  81 GFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVILGFYIVMGVYK 131
118496751  64 GFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVILGFYIVMGVYK 114
89255578   80 GFTTFSSFSLDILNLLQRGEIFIAIGYIWLVS------------------- 111
110669887  80 GFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVILGFYIVMGVYK 130
115314084  80 GFTTFSSFSLDILNLLQRGEIFIAIGYIWLVS------------------- 111
56707416   80 GFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVILGFYIVMGVYK 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap