Conserved Protein Domain Family
PRK14225

?
PRK14225: PRK14225 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172713
View PSSM: PRK14225
Aligned: 10 rows
Threshold Bit Score: 207.946
Threshold Setting Gi: 163844939
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
23500548    1 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 80 
17988814    1 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPALRQFV 80 
62317351    1 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 80 
83269328    1 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 80 
148558004   8 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 87 
161620876   4 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 83 
163844939   4 MRNWRQAENIMLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 83 
189022601   4 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 83 
225686581   4 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPALRQFV 83 
256015583   1 MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFV 80 
23500548   81 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 137
17988814   81 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 137
62317351   81 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 137
83269328   81 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 137
148558004  88 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 144
161620876  84 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 140
163844939  84 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 140
189022601  84 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 140
225686581  84 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 140
256015583  81 MGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap