Conserved Protein Domain Family
PRK14222

?
PRK14222: PRK14222 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172710
View PSSM: PRK14222
Aligned: 9 rows
Threshold Bit Score: 156.796
Threshold Setting Gi: 77918589
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118579272   1 MKSALTIALFCAGGGLARYYLSGWVYGLLGRAFPFGTLAVNLIGAYCIGLIMEISLRSTLIPATLRLGLTVGFMGGLTTF 80 
148263329   1 METVLYIAVFGALGCLSRYYLSGWVYELFGRAFPYGTFAVNIVGAFCIGLIMEFSLRSALVSPQLRIGLTIGFLGGLTTF 80 
77918589    1 -MHLVYIAIFGALGCLSRFMVSGWVYALIGRALPYGTLAVNVIGSLLLGLLMEGGLRSAALPADIRMGITTGFMGGFTTF 79 
78224209    1 MLTIVAIALFGALGCLARYLLAGWVYAFVGRGFPYGTLTVNVVGAFLIGLIMEFSLRTTLIPQELRIGLTIGFLGGLTTF 80 
39995610   17 MTTILAIAVFGAVGCVARYLLAGGVYALAGRAFPWGTLAVNVIGAFLIGLIMEAALRTTLMSQELRLGLTIGFLGGFTTF 96 
222055042   1 MQTVIFIGIFGALGCLCRYYLSGWVYDIVGRAFPYGTFAVNIIGAFLIGLIMEFSLRSTLVSPQLRVGLTIGFLGGLTTF 80 
189424020   1 MKTAATIALFCAGGGLTRYYLSGWIYGLLGRAFPYGTLVVNIIGAYCIGLIMELGLRSTMLSDTLRIGLTVGFMGGLTTF 80 
197117098   1 MEQLVYIALLGALGCLCRYFLSGFVYQVFGTSFPYGTLAVNLIGAFLIGLIMEFSVRSAAIPPTLRFAITIGFLGGLTTF 80 
253699357   1 MEQLVYIALLGALGCLCRYFLSGLVYQVFGTSFPYGTLAVNLIGAFLIGLVMEFSVRSAAIPPTLRFAITIGFLGGLTTF 80 
118579272  81 STFSYETFKLLEDGQYLVAMVNALASVVMCLLCTWLGVITARAL 124
148263329  81 STFSYETFRLLEDGELLIASANVLFSVMTCLVFTWLGIIVAKAL 124
77918589   80 STFSYETVRLLEDGSMVAAGANILLNVTVSVVFAGLGIFLARQL 123
78224209   81 STFSYETFRLLEDGEFITAAVNVLASVLVCLACTWLGIMTARHL 124
39995610   97 STFSYETFKLLEDGEFFSASLNVLASVALCLVGTWAGIMAARQL 140
222055042  81 STFSYETFRLLEDGELLIASVNVLTSVLVCLVFTWLGIAAARYI 124
189424020  81 STFSYETFKLLEDGQFVMAFTNVLASVAVCLLCTWLGIITVRSL 124
197117098  81 STFSFETFRLLEDGALLIAIVNVLVSVVACLTCTWIGIMVARAL 124
253699357  81 STFSFETFRLLEDGALLIAFVNVLVSVVACLTCTWIGIMVARAL 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap