Conserved Protein Domain Family
PRK14219

?
PRK14219: PRK14219 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172707
View PSSM: PRK14219
Aligned: 18 rows
Threshold Bit Score: 193.908
Threshold Setting Gi: 152977324
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
152977324   1 MVYLIVGLAGILGALSRYYLGLSIDVLWHHPFPLATLFINLIGCFLLSWIATYISRLNIFPSEVVTGIGTGFVGSFTTFS 80 
163942795   1 MIYIIVGIAGILGALSRYFLGLTIHTFWHHSFPLATLLINLAGCFLLAWLTTYIARLNILPSEVITGIGTGFIGSFTTFS 80 
218906274  11 LIYIIVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLAGCFLLAWLTTYIAKLNILPSDVITSIGTGFIGSFTTFS 90 
218900224  11 LIYIIVGIAGILGALSRYYLGLTIHTSWNHSFPLATLLINLLGCFLLAWLTTYIARRNILPLEIITGIGTGFIGSFTTFS 90 
217962557  11 LIYIIVGISGILGALSRYYLGLTIHESWHYTFPLATLLINLVGCFLLAWLTTYIAKLNILSSDVITGIGTGFIGSFTTFS 90 
218234176  11 LIYIIVGIAGILGALSRYYLGLNINTFWHHSFPLATLLINLIGCFFLAWLTTYIARLNILPSEVITGIGTGFIGSFTTFS 90 
222098526   4 LIYIIVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLVGCFLLAWLTTYIAQRNILPSEIITGIGTGFIGSFTTFS 83 
42784262    4 LIYIIVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLVGCFLLAWLTTYIAQRNILPAEIITGIGTGFIGSFTTFS 83 
49187929    4 LIYIIVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLAGCFLLAWLTTYIAKLNILPSDVITGIGTGFIGSFTTFS 83 
49481646    4 LIYIIVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLAGCFLLAWLTTYIAKRNLLPSDVITGIGTGFIGSFTTFS 83 
152977324  81 TFGVETMKLINQSAWSIAIVYVLCSIFGGLFMSSMGYKLGNILFTKRAVitkKGD 135
163942795  81 TFSVETVQLINHSEWSTAFLYVSCSILGGLIMSGLGYTLGDFLIKKHLT---EGD 132
218906274  91 TFSVETVQLINYSEWSIAFLYVSCSILGGLFMSALGYTLGDFLLKKHLT---EGD 142
218900224  91 TFSVETVQLINHSEWDTAFLYVSCSILGGLIMSGLGYTLGDFLIKKHLT---EGD 142
217962557  91 TFSVETIQLINHSEWSIAFLYVSCSILGGLIMSGLGYTLGNFLLKKHLT---EGD 142
218234176  91 TFSVETVQLINHSEWSIAFLYVSCSILGGLIMSGLGYTLGDFLIKKSLT---EGD 142
222098526  84 TFSVETIQLINHSEWSIAFLYVSCSILGGLIMSGLGYTLGDFLIKKHLT---EGD 135
42784262   84 TFSVETIQLINHSEWSIAFLYVSCSILGGLIMSGLGYTLGDFLIKKHLT---EGD 135
49187929   84 TLSVETIQLINHSEWGIAFLYVSCSILGGLIMSGLGYTLGDFLLKKHLT---EGD 135
49481646   84 TFSVETVQLINYSEWSIAFLYVSCSILGGLIMSGLGYTLGDFLLKKHLT---EGD 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap