Conserved Protein Domain Family
PRK14217

?
PRK14217: PRK14217 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172705
View PSSM: PRK14217
Aligned: 5 rows
Threshold Bit Score: 193.296
Threshold Setting Gi: 54293501
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52840757    1 MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTLGSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFT 80 
54296543    1 MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTLGSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFT 80 
54293501    1 MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTLGSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFT 80 
148360874   1 MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTLGSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFT 80 
296106061   1 MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTLGSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFT 80 
52840757   81 TFSSFAAESLFMFEQGYWFKLMTNILVNNVGSLSMVFIGTLVAKYVLLGHQGSN 134
54296543   81 TFSSFAAESLFMFEQGYWFKLITNILVNNVGSLSMVFIGTLVAKYVLLGHQGSN 134
54293501   81 TFSSFAAESLFMFEQGYWFKLITNILVNNVGSLSMVFVGTLVAKYVLLGHQGSN 134
148360874  81 TFSSFAAESLFMFEQGYWFKLITNILVNNVGSLSMVFIGTLVAKYVLLGHQGSN 134
296106061  81 TFSSFAAESLFMFEQGYWFKLITNILVNNVGSLSMVFIGTLVAKYVLLGHQGSN 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap