Conserved Protein Domain Family
PRK14215

?
PRK14215: PRK14215 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172703
View PSSM: PRK14215
Aligned: 5 rows
Threshold Bit Score: 134.18
Threshold Setting Gi: 219848344
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222525910   1 MNNILAIALGAAIGANLRYGIGLWAAQRFGTAWPYGTFIINLLGCLGIGLLLTLISTRLTLSEPVRLMLVTGLLGGFTTF 80 
219848344   1 MNNILAIAIGAAIGANLRYGIGLWAAQRLGTTWPYGTFIINLLGCLLIGLLLTLAANRLTLSEPMRLMLVTGLLGGFTTF 80 
163848023   1 MNNILAIALGAAIGANLRYGIGLWAAQRFGTAWPYGTFIINLLGCLGIGLLLTLISTRLTLSEPVRLMLVTGLLGGFTTF 80 
148656615   1 -MNIIAIAVGAAIGANLRYSLSIWAAQRWGASFPYGTLIVNVIGSFAIGFVLVLATTRLSLSDTARLLIVTGLLGGFTTF 79 
156742803   6 LLNAIAIAVGAAIGANLRYSLSLWAAQRWGASFPYGTLIVNVIGSFLIGLVLVLATTRLNLSDLARLLIVTGLLGGFTTF 85 
222525910  81 STFGYESFSLLSSGNWLPAIGYMVGSVVGGLIAVIIGVGLGRWFGG 126
219848344  81 STFGYESVTLLNSGNWLAALSYVSGSVIGGLIAVIIGIGLGRWIGG 126
163848023  81 STFGYESFSLLSSGNWLPAIGYMVGSVVGGLIAVIIGVGLGRWFGG 126
148656615  80 SSLSFETYTLVTSGSWMAAGLYVLSSFGLGIAGVFLGAGVARVLP- 124
156742803  86 SSLSFETYSLIVSGSWRVAGIYLASSFGLGMAGVFLGAGVARLLP- 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap