Conserved Protein Domain Family
PRK14211

?
PRK14211: PRK14211 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172699
View PSSM: PRK14211
Aligned: 3 rows
Threshold Bit Score: 139.682
Threshold Setting Gi: 226305814
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
111023374   1 MTVLLVALGGALGATTRYLTGRYVDSYRSFPVATFLVNVAGCLILGLLSGASLSEQTFALLGTGFCGGLTTYSTFAVESV 80 
226365878   1 MTVLLVAAGGALGATTRYLTGRYVDSYRSFPVATFLVNVAGCLILGLLSGASMSAQTFALLGTGFCGGLTTYSTFAVESV 80 
226305814   1 MTVLLVALGGGAGASGRYLLARYVPAYKGFPAATFAANVIGCFLLGLFTGAALSTEMAALLATGFCGGLSTYSTFATENV 80 
111023374  81 GLLRIRRALPSVVYVVASVAAGLAAAWLGFRLTS 114
226365878  81 GLLRIRLALTSVVYTVASVAAGLAVAWLGFRLTS 114
226305814  81 GMVERRQTTLSLIYIVVSLIVGLSAAWVGIQLTN 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap