Conserved Protein Domain Family
PRK14210

?
PRK14210: PRK14210 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172698
View PSSM: PRK14210
Aligned: 3 rows
Threshold Bit Score: 107.785
Threshold Setting Gi: 60680682
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
60680682    1 MKEIIYIFIGGGMGSVTRYLTQIAVNERLSPAlfpFPWGTFAVNIIGSLLIGFFYSFSERFNLSFELRLFLTVGFCGGFT 80 
150006320   1 MKSLLLIFLGGGTGSVLRYLLTISIYRQGTTN---FPWGTFAVNILGCILIGVFYTLTSRIHINNDIRLMLTIGLCGGFT 77 
53712482    1 MKEIIYIFIGGGMGSVTRYLTQIAVNERLSPAlfpFPWGTFAVNIIGSLLIGFFYSFSERFNLSFELRLFLTVGFCGGFT 80 
60680682   81 TFSTLANDSLSLLKGGFYGIFTFYVFISILLGLLAVLAGGYLGE 124
150006320  78 TFSTFSNESLQLLKSGLYPSFFTYIIGSVVLGILGVMLGIWMSE 121
53712482   81 TFSTLANDSLSLLKGGFYGIFTFYVFISILLGLLAVLAGGYLGE 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap