Conserved Protein Domain Family
PRK14208

?
PRK14208: PRK14208 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172696
View PSSM: PRK14208
Aligned: 4 rows
Threshold Bit Score: 165.133
Threshold Setting Gi: 153006440
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86159901    1 MARLLLVCLGGALGSGARYLTSAWALRAFGPDFPRGTLLVNVSGSFLLAGIMTASLQSEAFPPDLRLFLAAGVMGGFTTY 80 
153006440  13 VIRLLLVCAGGALGSGARYLVSTWAARALGADFPRGTLIVNVLGSFLLALLLGLAGTREAITPEARLFLGAGVLGGFTTY 92 
220918727   1 MARLLLVCLGGALGSGARYLTSAWALRAFGPDFPRGTLLVNVSGSFLLAGIMTASLQSEAVPPDLRLFLAAGVMGGFTTY 80 
197123958   1 MARLLLVCLGGALGSGARYLTSAWALRAFGPDFPRGTLLVNVSGSFLLAGIMTASLQSEAVPPDLRLFLAAGVMGGFTTY 80 
86159901   81 SSFNYETLALLEQGRLAAAAGYLLaTVLGCLAAAVAATLLVRWLAG 126
153006440  93 SSFNYETLALLERGVWPAAVNVAL-TVLGCLAAGFAGIVAARALAG 137
220918727  81 SSFNYETLALVEQGRLAAAAAYLLaTVLGCLAAAFAATLLVRWLAG 126
197123958  81 SSFNYETLALVEQGRLAAAAAYLLaTVVGCLVAAFAATLLVRWLAG 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap