Conserved Protein Domain Family
PRK14207

?
PRK14207: PRK14207 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172695
View PSSM: PRK14207
Aligned: 7 rows
Threshold Bit Score: 178.785
Threshold Setting Gi: 14520874
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
212223944   1 MNGRIAVAIALGGALGALARFYISGILPVYKDFPVGTLLVNSIASFILGYIYGLLFWGIDVPADWRAFFGTGFCGALSTF 80 
57640449    1 MNLRIAMAIALGGAFGAVARFYISGLLPVYRDFPVGTLMVNSIASLILGYLYGLLFWGFDVPPDWRAFFGTGFCGALSTF 80 
18977607    1 MDLREVALVLIGGGTGAVARYYLSGVLPVYRSFPVGTLLVNSLASFLLGYLYGLIFWGLDVSRESRLFLGTGFCGGLSTF 80 
14591286    1 MNAKIIALLIIGGGLGALTRYYISGVLPVYKDFPIGTLIVNSLASFLLGYIYGLLFSGFDISPEWRIFLGTGFCGGLSTF 80 
14520874    1 MNLKTTLLLIIGGGLGALARYYISGILPVYKDFPLGTLLVNSIASFILGYLYGLLFFGFEVSSEWRIFLGTGFCGGLSTF 80 
240103730   1 MNAKMALAVAAGGALGALFRFYLSGLLPVYRDFPVGTLMVNGLASFILGYLYGLLFWGFDVPSDWRAFLGTGFCGGLSTF 80 
242398474   6 MNAKVLLAVGVGGMLGAIMRYSIAGLLPVYKDFPVGTLLVNSIASFLLGYLYGLVFFGYEVSPNWRVFFGTGFCGGLSTF 85 
212223944  81 STFSYETFSLLREREYFLAALNISANVIITVSLVFIGFILARR 123
57640449   81 STFSYETFSLLREREYLIATLNILANVIITIALVFAGFMLARR 123
18977607   81 STFSYETFSLIREGEYLTALLNIFANVLATIFLVFLGFVLARR 123
14591286   81 STFSYETFSLLREGEIWLAFANITTNILVTIFLVFLGFILARR 123
14520874   81 STFSYETFSLLREGEYLLAFMNVVANVLVTITLVFLGFILARR 123
240103730  81 STFSYETFSLLREREYIMAGLNVAANVFVTISLVFIGFLLARR 123
242398474  86 STFSYETFSLLREREHFLALLNISANIIITVSLVFLGFVLARR 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap