Conserved Protein Domain Family
PRK14206

?
PRK14206: PRK14206 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172694
View PSSM: PRK14206
Aligned: 4 rows
Threshold Bit Score: 189.247
Threshold Setting Gi: 182416352
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83312505    2 LTYALVALGSAIGGTLRYWLSMVIAEASAGTFPWATLVINVAGSAAIGLFATLTSVDGRVFVPSEWRTFFMVGICGGFTT 81 
83591576    1 MTYLFVAAGGALGSTLRYWLSGLIAGAIGQSFPWGTLVINISGSIVIGAFATLTGPDGRVFIPGDWRQFFMVGVCGGYTT 80 
182416352   2 SLYLYIALGGALGSVGRFALSGLVAQHYGETFPWGTLVVNVVGSFIIGFFATLTAPEGRMLVGATGRHFVMTGVLGGFTT 81 
217977159   1 MDYLWIMIGSALGGAARFWVTGFVAEQTGGIFPWGTVLINVSGSFLIGFFGSLTGAEGRFVVGESARLFVMIGLCGGFTT 80 
83312505   82 FSSFSLQTLALAQDGDWLAAGLNVVGSVALCLLAVWLGHVAATIINR 128
83591576   81 FSSFSLQTLTLAQEGQGLWAAANVVLSVVFCLIGVWLGHVGAVLINE 127
182416352  82 FSSFSLQTLNLLRDGDWGRAGGNVVGSLVLCLVAVWLGHIAAVGLNS 128
217977159  81 FSSFSLQTLNLMRQGEMIRAGGNIALSVVFCLLAVWLGHVVAVAINQ 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap