Conserved Protein Domain Family
PRK14205

?
PRK14205: PRK14205 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172693
View PSSM: PRK14205
Aligned: 20 rows
Threshold Bit Score: 159.581
Threshold Setting Gi: 239826345
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
217962558   1 MIEALLVATGGFFGAITRFAISNWFKKRNKTSFPIATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTTFSTFKL 80 
218235771   1 MIEALLVATGGFFGAITRFAISNWFKKRNKTQFPIATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTTFSTFKL 80 
218900225   1 MIEALLVATGGFFGAITRFAISNWFKKRNKTQFPIATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTTFSTLKL 80 
163942796   1 MMGALLVATGGFFGAITRFAISNWFKKRNKTPFPIATFLINITGAFLLGYIIGNGVSTEWQLLLGTGFMGAFTTFSTLKL 80 
222098527   1 MIEALLVATGGFFGAITRFAISNWFKKRTKTSFPIATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTTFSTFKL 80 
30023105    1 MIEALLVATGGFFGAITRFAISNWFKKRNKTQFPLATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTTFSTFKL 80 
49481647    1 MIEALLVATGGFFGAITRFAISNWLKKRNKTQFPIATFLINITGAFLLGYIIGSGVTTGWQLLLGTGFMGAFTTFSTFKL 80 
52140453    1 MIEALLVATGGFFGAITRFAISNWFKKRNKTSFPIATFLINITGAFLLGYIIGSGVTTGWQLLLGTGFMGAFTTFSTFKL 80 
42784263    1 MMEALLVATGGFFGAITRFAISNWFKKRTKTSFPIATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTTFSTFKL 80 
152977325   3 EYHALLVAIGGFFGAITRFYISNWFKKRKKTSFPLATFFINITGAFLLGLIAGKGIDKSWQLLLGTGFMGAFTTFSTFKL 82 
217962558  81 ESVQLLNRKSFSTFLLYLSATYIVGILFAFLGMQLGGI 118
218235771  81 ESVQLLNRKKLYIFLLYLSATYIIGILFAFLGMKLGGI 118
218900225  81 ESVQLLNRKKLYIFLLYLSATYIIGIAFAFLGMKLGGI 118
163942796  81 ESIQLLNRKKIYTFLLYLSTTYIIGILFAFLGMKLGGI 118
222098527  81 ESIQLFNRKNLSILFLYLSATYIIGILFAFLGMQLGGI 118
30023105   81 EAVQLLNRKNISTFLLYLSATYIIGILFAFLGMKLGGI 118
49481647   81 ESVQLLNRKNFSTFLLYLSATYIVGILFAFLGMKLGGI 118
52140453   81 ESVQLLNRKNFSTFLLYLSATYIVGILFAFLGMQLGGI 118
42784263   81 ESIQLFNRKNLSILFLYLSATYIIGILFAFLGMQLGGI 118
152977325  83 ESIQLFTNKKCGTGFLYIGATYISGIILACIGIKIGSL 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap