Conserved Protein Domain Family
PRK14204

?
PRK14204: PRK14204 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172692
View PSSM: PRK14204
Aligned: 9 rows
Threshold Bit Score: 182.043
Threshold Setting Gi: 108563592
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109948083   1 MNLVFLWAALGGALGSSLRYFVGKMMPSKFLMFESFPLGTFSVNLIGCFVIGLMGHLAAKKVFGDDFGIFFVTGVLGGFT 80 
108563592   1 MNFVFLWAALGGAIGSSLRYFVGKVMPSKFLMFESFPLGTFSVNLIGCFVIGFMGHLAAKKVFGDDFGIFFVTGVLGGFT 80 
15645839    1 MNFVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNIIGCFVIGFMGHLAVKKVFGDDFGIFFVTGVLGGFT 80 
15612211    1 MNLVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNLIGCFIIGFMGHLAAKKVFGDDFGIFFVTGVLGGFT 80 
208435119   1 MNFVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNIIGCFVIGFMGHLATKKVFGDDFGIFFVTGVLGGFT 80 
188528012   1 MNFIFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNVIGCFVIGFMGHLAVKKVFGDDFGIFFVTGVLGGFT 80 
210135384   1 MNFVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNIIGCFVIGFMGHLAVKKVFGDDFGIFFITGVLGGFT 80 
254779769   1 MNFVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNIIGCFVIGFMGHLAAKKVFGDDFGIFFVTGVLGGFT 80 
298735756   1 MNFVFLWAALGGAIGSSLRYFVGKMMPSKFLMFESFPLGTFSVNVIGCFVIGFMGHLAAKKVFGDDFGIFFVTGVLGGFT 80 
109948083  81 TFSSYGLDTLKLLQKSQYIEAISYVLGTNILGLIGVAIGWFLAKNFV 127
108563592  81 TFSSYGLDTLKLLQKSQYLEAVSYVLGTNLLGLIGVAIGWFLAKNFV 127
15645839   81 TFSSYGLDTLKLLQKSQYIEAVSYALGTNILGLTGVAIGWFLAKNFV 127
15612211   81 TFSSYGLDTLKLLQKSQYLEAISYVLGTNLLGLIGVAIGWFLAKNFV 127
208435119  81 TFSSYGLDTLKLLQKSQYIEAISYVLGTNLLGLIGVAIGWFLAKNFV 127
188528012  81 TFSSYGLDTLKLLQKSQYIEAVSYALGTNILGLIGVAIGWFLAKNFV 127
210135384  81 TFSSYGLDTLKLLQKSQYIEAISYVLGTNILGFIGVAIGWFLAKNFV 127
254779769  81 TFSSYGLDTLKLLQKSQYLEAISYVLGTNLLGLIGVAIGWFLAKNFV 127
298735756  81 TFSSYGLDTLKLLQKSQYLEAISYVLGTNLLGLIGVAIGWFLAKNFI 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap