Conserved Protein Domain Family
PRK14202

?
PRK14202: PRK14202 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172690
View PSSM: PRK14202
Aligned: 11 rows
Threshold Bit Score: 146.398
Threshold Setting Gi: 194333037
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78187882    2 SINHPLSVLLVGAGGFLGTVARYLVALAFSPASPGFPFATFSVNIAGSFLIGFLSELAVSTTIVSPEARLFLVTGFCGGF 81 
78187996    1 MVDKAAHILLVGVGGFLGSVARYLVALWMAPITAVFPFATLTVNLLGSFLIGFISELALSTSLISPSTRIFLVTGFCGGF 80 
145220486   1 -MMQFSSVLLAGAGGFLGTVARYLVALAFSPSMPGFPFATFTVNILGSFLIGFISELAVSSTIISPQARLFLVTGFCGGF 79 
119358327   2 LMKQVSAFLLVGIGGFLGSAARYGASLLLSPVAGGLPLATFSVNIIGCFFIGFISELALSTTLVSPESRLFLVTGFCGGF 81 
21674911    1 --MVMKNVLLVGAGGFAGSVARYLVALAVPFSGTGFPFATFAVNLLGSFLIGFISELALSTTLLSPEARLLLTTGFCGGF 78 
193211817   1 ----MKNVLLVGAGGFAGSVARYLVALAVPFSGTGFPFATFAVNLLGSFLIGFISELALSTTLLSPEARLLLTTGFCGGF 76 
194337774   1 -MKQAGAVLLVGVGGFIGSMARYLVALTFVPLVPGFPFATLTVNLLGSFLIGFLSELAVSTTLVSPEARLLLVTGFCGGF 79 
194333037   1 MQERFSAVLLVGAGGFAGASARYLIAVALSSFATGFPMATMLVNVLGCFLIGMISELSLTTSLLPSELRLLLATGFCGGF 80 
193214272   1 -MQSLTPYLLVGIGGMAGAVLRYAVSLAGQFITTGFPFATLTVNILGSFLIGLFAELSATTTLISPEMRLLLATGLCGGF 79 
189347869   3 GNSLPANVLLVGAGGFLGSAARYLVALAMPFAGTGFPLATFAVNMLGSFLIGLLSELAVSTTMVSPETRLFLVTGFCGGF 82 
189499184   1 MPERYAALLLVGAGGFVGATARFLVALVLPFIGTGFPFGTLAVNLAGCFLIGFISQLSVSSSLVSPELRLLLATGFCGGF 80 
78187882   82 TTFSSYMFEGATLARDGELFYFSLYLAGSIVGGFVALYTGIIAAKpWS 129
78187996   81 TTFSSYMIEHSALLRDGEHLYAALYLFGSLIGGFIALYLGIISAR-WM 127
145220486  80 TTFSSYMYEGASLVRDGQLLYTGVYLAGSVIGGFAALYSGTLAAKpWT 127
119358327  82 TTFSSYIFENASLLKDGQMLYTSAYLAGSVIGGFVALYSGTFFAKiWT 129
21674911   79 TTFSTAMYETGGLMRDGEALYASLYVAGSLAGGLACLFSGTLLAKlWQ 126
193211817  77 TTFSTAMYETGGLMRDGEALYASLYVAGSLVGGLACLFSGTLLAKlWQ 124
194337774  80 TTFSAYMFENAALLKDGQLFYAGIYLVGTIIGGFVALYTGTLFAKlWT 127
194333037  81 TTFSSYMYEISALLKDGELFYASLYLIGSLVGGMVFLYLGMALARvWS 128
193214272  80 TTFSSFMYEIHGLLQDGQIFYASLYIGLSAVGGFLALYCGILFSKiWS 127
189347869  83 TTFSSYMYENAALVRDGQVFYTTIYLAGSIAGGFLALYSGMLIAKlWS 130
189499184  81 TTFSSYMYEIMSLLRDGEIFYSTLYLLGSIVGGILCLYFGMQLAKlWA 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap