Conserved Protein Domain Family
PRK14199

?
PRK14199: PRK14199 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172687
View PSSM: PRK14199
Aligned: 4 rows
Threshold Bit Score: 158.786
Threshold Setting Gi: 150019764
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150019764  16 KEEIILQkiIYVGIGGCIGAVMRYLVTMQSAKMINSNIPLGTLIVNVVGGFLIGMIMELSVSTDLISPNLKLFLTTGVMG 95 
18310011    1 MQKLLLA--LIVGLGGFLGASLRYLISIFAAKNFGGNFPYGTLIANILGALLIGFIMEFSMDSALISSNMKLFLTTGIMG 78 
118443113   1 MEKLILA--IIVGCGGFIGAALRYLISENTSKMFNGNFPYGTLIVNIVGAIIIGFIMDINANTSLISGHTKLFLTTGMMG 78 
110799749   1 MQKLLLA--LIVGLGGFLGASLRYLISIFAAKNFGGNFPYGTLIANILGALLIGFIMEFSMDSALISSNMKLFLTTGIMG 78 
150019764  96 GLTTFSTFSYETINLISDGRYLFGIANILLNVFLSIGGVALARLVCSISI 145
18310011   79 GLTTFSTFSYETISMLTNGNMTLGIENIILNLGCSLLFVVIGQKLARILF 128
118443113  79 GLTTFSTFSYETINLINCGNILMGCTNAALNLGLSLVGVIIGQALGKIVY 128
110799749  79 GLTTFSTFSYETISMLTNGNITLGIENIILNLGCSLLFVVIGQKLARILF 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap