Conserved Protein Domain Family
PRK14198

?
PRK14198: PRK14198 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172686
View PSSM: PRK14198
Aligned: 9 rows
Threshold Bit Score: 146.816
Threshold Setting Gi: 170739947
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209884048   1 MNYLLIFVGGGIGASLRHAVNELCVRlFGLGFPIGTFLINITGSLVMGLIAGYLAFKGAAAQPWRLFVMVGLLGGYTTFS 80 
220920978   2 LNTLVVFVGAGLGGALRHGVNLAAAR-LGGSFPAGTMIINIAGSLAMGLLTGWFAVRGGMPQAWRLFLTTGILGGFTTFS 80 
192290287   1 MAYLLVFVGGGLGAMFRHFINTLSGRlLGTAFPYHTFFINVTGSIVMGLIAGYLAFKGGSSQHFRLFLMTGILGGYTTFS 80 
92118891    1 MNYLLVFVGGGLGATVRHAVNMICARaFGTHFPFGTFLINVSGSVVMGLIAGYLAFRGSAAQPWRLFVMTGVLGGYTTFS 80 
91978085    1 MTYLLVFLGGGLGAMFRHFINTVSGRmLGTAFPYHTFFINVSGSLVMGLIAGYFAFKGGSSQHVRLFLMTGILGGYTTFS 80 
148252894   5 FGYVLVFFGGGCGASLRHAINMASARaLGTDFPYGTFIINISGSIVMGLIAGYLTFKGSATQHWRLFLMTGILGGYTTFS 84 
146343079  11 FGYLLVFFGGGCGASIRHAVNMASARvLGTDFPWGTFIINITGSTVMGLIAGYLTFKGGATQHWRLFLMTGILGGYTTFS 90 
39934764   26 MAYLLVFVGGGLGAMFRHFINTLSGRlLGTAFPYHTFFINVTGSIVMGLIAGYLAFKGGSSQHFRLFLMTGILGGYTTFS 105
170739947   2 LNTLVVFLGAGLGGALRYGVNVSAAR-LGGSFPAATMIINVSGSLAMGILAGWFVVRAGLPQSLRLFLTTGILGGFTTFS 80 
209884048  81 SFSLDAVTLYERGAWGAALGYVVGSVALGIIGLVAGLAVVRHFS 124
220920978  81 TFSLEAFLLMERGAFAAAALYVLGSVAAGIAGVGASLAVIRQFG 124
192290287  81 AFSLDAALLYERGAVGLAVVYVLGSVVLAIAGLFGGMALIRAMT 124
92118891   81 AFSLDTALLYERGEIGLAALYAIGSVVLAVVGLFAGLALVRHLT 124
91978085   81 AFSLDAALLYERGAVGLAALYVLGSVALAIAGLFAGLALIRAIT 124
148252894  85 AFSLDTALLYERGALGLAALYVLGSVGISIAGLFAGLALVRYLT 128
146343079  91 AFSLDTALLYERGALGLAAAYVLGSVGISIAGLFAGLALVRILS 134
39934764  106 AFSLDAALLYERGAVGLAVVYVLGSVVLAIAGLFGGMALIRAMT 149
170739947  81 TFSLEAFLLIERGALAQAVLYVIGSVAAGIAGVAVSFAIIRHFG 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap