Conserved Protein Domain Family
PRK14197

?
PRK14197: PRK14197 
fluoride efflux transporter CrcB
Statistics
?
PSSM-Id: 172685
View PSSM: PRK14197
Aligned: 22 rows
Threshold Bit Score: 156.84
Threshold Setting Gi: 157962051
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145301141   1 MQTWLFVAAGGAIGACLRFGISELMALLLGRHFPYGTLVVNVVGSFIMGIAFALISHGHvVEHPMKPLLMVGILGALTTF 80 
119774910   1 MNNVLYIAAGGAIGAVLRYSISILALQLFGTGFPFGTLIVNVAGSFLMGCIYALAELSH-IGPEWKALIGVGLLGALTTF 79 
127512949   1 MNNLIFVALGGSIGAVFRYLISIFMIQVFGSSFPFGTLMVNVIGSFLMGVIYALGEASQ-VSPEIKALVGVGLLGALTTF 79 
157375267   1 MNNILFVALGGSIGAVFRYLLSIFMLQLFGSAFPFGTLLVNVIGSFLMGTIYALGQVSQ-VSPEIKALVGVGLLGALTTF 79 
114562973   1 MTNVLLVALGGSIGAVLRYLLSIFMIQVFGSSFPFGTLLVNLLGSFLMGAVYALGQLSH-ISPEIKALIGIGLLGALTTF 79 
91793102    1 MTNLLFVALGGSIGAVLRYLMSIIMIQLFGSSFPFGTLLVNVLGSFFMGIVYALGQVSH-VSPELKALVGVGLLGALTTF 79 
167624138   1 MNNVLFVALGGSIGAVLRYLISLLMLQVFGSGFPFGTLVVNILGSFLMGVIFALGQVSE-LSPEIKAFIGVGMLGALTTF 79 
157962051   1 MNNVLFVALGGSIGAVLRYLISLLMLQVFGSGFPFGTLVVNILGSFLMGVIFALGQVSE-LSPEFKAFIGVGMLGALTTF 79 
170726826   1 MNNILFVALGGSIGAVFRYLISIFMVQLFGSAFPFGTLLVNIIGSFLMGVIYALGQVSE-VSPEIKALVGVGLLGALTTF 79 
212635389   1 MNNVLFVALGGSIGAVLRYLISILMLQVFGSGFPFGTLMVNILGSFLMGVVYALGQVSE-VSPEIKAFIGVGMLGALTTF 79 
145301141  81 SSFALDTVVLAQQGAYLKAVLNMGLNLSLCLAMVLLGMQLVASRV 125
119774910  80 STFSNETLLLLQQGELVKASLNVLLNLILCLTVVYLGQQLIYSRV 124
127512949  80 STFSNETLLLMQQGAWLKAFTNIALNLCLCLFMVYLGQQLVFSRI 124
157375267  80 STFSNETLLLIQSGAWIKAFFNIALNLCLCIFMVYLGQQLVFSRI 124
114562973  80 STFSNETLLLLQEGLWHKAILNVLLNVTLCLFMVYLGQQLIFSRV 124
91793102   80 STFSNETLLLMQQGYWFKSLINVLLNVSLCIFMVYLGQQLVFSRV 124
167624138  80 STFSNESLLLMQEGELVKAVLNVVVNVGVCIFVVYLGQQLVFSRF 124
157962051  80 STFSNETLLLMQQGYLVKAVFNVVVNVGVCIFVVYLGQQLVFSRF 124
170726826  80 STFSNETLLLIQSGAWLKAFLNIALNLCLCIFMVYLGQQLVFSRI 124
212635389  80 STFSNESLLLMQEGYLVKAILNVVVNVGVCIFVVYLGQQLVFSRY 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap