Conserved Protein Domain Family
PRK14194

?
PRK14194: PRK14194 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172682
View PSSM: PRK14194
Aligned: 7 rows
Threshold Bit Score: 529.032
Threshold Setting Gi: 167033111
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146308488   4 QAPIKLIDGKAAAARVLAEVAEDVRALKAAGIVPALAVVLVGDDPASQVYVRNKVLRAEECGIRSLEFKLPADTAEARLQ 83 
229589806   1 MNAHKLIDGKAAAARVLLQVREDVARLHGQAIQPALAVILVGNDPASQVYVRNKILRAEEVGIRSVEHRLPSDTSTEQLL 80 
167033111   4 LTSLKLIDGKATAARVLAEVREQVQELRQGGVQPGLVVVLVGADAASQVYVRNKVLRAEEVGIRSQEHRLPADTTQAHLL 83 
71738145    1 -MSARIIDGKAAAARVLEQVSTEVKILKADGIEPALAVILVGNDPASEVYVRNKILRAEEAGIRSLEHRLPAKSSQAQVL 79 
146308475   4 VLSPKLIDGKAAAARVLAEVTEDVRTLKAAGIKPALAVVLVGDDPASQVYVRNKVLRAEECGIRSLEHKLPADTAEADLL 83 
66045465    1 -MSAHIIDGKAAAARVLQQVRHDVNILKAEGIEPALAVILVGNDAASEVYVRNKILRAGEAGIRSLEHRLPADSSQARLL 79 
28869648    1 -MSARIIDGKAAAARVLGQVRDDVHTLKAEGIEPALAVILVGNDPASEVYIRNKIVRAEEAGIRSLEHRLPADCSEARLL 79 
146308488  84 ALIAELNADASVHGILVQLPLPAHIDEQRVLQAVTPLKDVDGFHAENVGGLSQGREVLTPCTPAGCLRLLQDSCGDLTGK 163
229589806  81 ILIGQLNADPAIHGILLQLPLPAQMDELRALEAIAPDKDVDGFHSQNVGGLSQGRAVLTPCTPSGCLYLLEHTCGDLRGK 160
167033111  84 TLIDRLNRDPEVNGILVQLPLPAHIDEHCVLQAINPLKDVDGFHSENVGGLAQGRDVLTPCTPSGCMRLLRDACGELRGK 163
71738145   80 ALIAELNADDSVNGILLQLPLPSHMEEARALQAIDPGKDVDGFHSENVGGLSQGRSVLTPCTPSGCMHLLEETCGDLSGK 159
146308475  84 ALIHSLNADYSVHGILVQLPLPAHIDETRVLQAINPLKDVDGFHAENVGGLSQGRDVLTPCTPAGCLRLLQDSCGDLTGK 163
66045465   80 ALIAELNADNTVNGILLQLPLPAHIDENRVLQAIDPDKDVDGFHSENVGGLSQGRNVLTPCTPSGCLHLLEETCGDLSGK 159
28869648   80 ALIAELNTDRSVNGILLQLPLPAHINEAHALQAIAAAKDVDGFHSENVGGLSQGRNVLTPCTPSGCMHLLKETCGDLTGK 159
146308488 164 HAVVIGRSNIVGKPMAALLLKAHCSVTVVHSKSANLKTLCRQADIVVAAVGRPRLVDADWLKPGAVVIDVGINRIDENGR 243
229589806 161 HAVVIGRSNIVGKPMAALLLKADCSVTVLHSRSHDAQALCRQADIVIAAVGRARLIDASWLKPGAVVIDVGINRIDDDGR 240
167033111 164 HAVVVGRSNIVGKPMAALLLQADCTVTVVHSRSRDLPALCRQADILVAAVGKPRLIGADCLKPGAVVIDVGINRINEDGQ 243
71738145  160 HAVVIGRSNIVGKPMAALLLQAHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDASWLKPGAVVIDVGINRIEDQGR 239
146308475 164 HAVVIGRSNIVGKPMAALLLKAHCSVSVVHSKSANLRELCRQADIVVAAVGKPRLVDADWLKPGAVVIDVGINRIDEGGR 243
66045465  160 HAVVIGRSNIVGKPMAALLLQAHCSVTVVHSRSTDARALCQLADIVVAAVGRPRLIDASWLKRGAVVIDVGINRIEDHGR 239
28869648  160 HAVVIGRSNIVGKPMAALLLQAHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDAGWLKPGAVVIDVGINRIDDQGR 239
146308488 244 SRLVGDVDFDSALPQVSAITPVPGGVGPMTIAYLMKNTLVAARLQQTAPSnltQRAEAACPSIS 307
229589806 241 SRLVGDVDFDSALPHVAAITPVPGGVGPMTIAFLMKNTVAAAQAQHHALR---SQSEAVCHSIY 301
167033111 244 NHLVGDVDFAAALPQVAGITPVPGGVGPMTIAYLMKNTLLALDLQQQAAH----QERTACLSPC 303
71738145  240 SRLVGDIDFDNALSVASAITPVPGGVGPMTIAFLMKNTVTAARQQALAQR---SQSEAVCLSTC 300
146308475 244 SRLVGDVDFDSALTRAAAITPVPGGVGPMTIAFLMKNTLVAARLQHPATGlplSTLENPA---- 303
66045465  240 SRLVGDVDFASATEVASAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQR---SQPEAVCLSTY 300
28869648  240 SRLVGDVDFDNALDVVSAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQR---SQSEAVCLSIY 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap