Conserved Protein Domain Family
PRK14191

?
PRK14191: PRK14191 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172679
View PSSM: PRK14191
Aligned: 15 rows
Threshold Bit Score: 496.596
Threshold Setting Gi: 118475042
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15611591    6 VVLLDGQALAYNIEKDLKNKIQIITAQTHKRPKLAVILVGKDPASITYVNMKIKACQRVGMDFDLKTLKENITEAELLSL 85 
15645202    8 VVLLDGQALADNIEKDLKHKIQIITAQTHKRPKLAVILVGKDPASITYVNMKIKACERVGMDFDLKTLQENITEAKLLSL 87 
32266865    1 MTLLDGKSLSVTIERDLTEQIAALV-SQGVTPGLAVILVGNNPASCAYVQMKAKACKRVGIYSVTHEMPSKITQDELLSV 79 
34557701    1 MQLLDGKALSLEIEAKVKEEVMILTSSRGVTPGLAVILVGSDPASQAYVNMKAKACKRAGIYSITHEMPESTTESQLLNA 80 
157163934   1 MKILDGKAVSLKVKESVKVRADELK-KFGVEPTLAVVLVGEDKASQTYVRAKEKACNEYGIKSVAHRLSENTTQNELLAL 79 
154174422   1 MKILDGKATSAKVKAEVKERASALK-NAGIEPALAVILVGSDKASQTYVAAKQKACEASGIRSVMHKLPQTTSQNELLAL 79 
118475042   1 MQIIDGKSVSAKVKEYVKNEAISLK-KSGITPTLAVILVGEDKASQTYVASKEKACLACEMGSVMHRLSKETSQSELLAL 79 
210134778   6 VVLLDGQALAYDIEKDLKNKIQIITAQTHKRPKLAVILVGKDPASITYVNMKIKACERVGMDFDLKTLQENITEAELLSL 85 
188527576   6 VVLLDGQALAYDIEKDLKNKIQIITAQTHKRPKLAVILVGKDPASITYVNMKIKACERVGMDFDLKTLQENITETELLSL 85 
254779431   6 VVLLDGQALAYDIEKDLKHKIQTITVQTHKSPKLAVILVGKDPASITYVNMKIKACQRVGMDFDLKTLQENVTEAKLLSL 85 
15611591   86 IKDYNTDQNISGILVQLPLPRSIDTKMILEAIDPNKDVDGFHPLNIGKLCTQKESFLPATPMGVMRLLEHYHIEIKGKDV 165
15645202   88 IKDYNTDQNISGVLVQLPLPRHIDTKMILEAIDPNKDVDGFHPLNIGKLCTQKESFLPATPMGVMRLLEHYHIEIKGKDV 167
32266865   80 IEILNNDPNIDGILVQLPLPAHIQTSKVLEAINPKKDVDGFHPFNIGRLSVNVDTFVPATPLGVMKLLESYHIDVRGKDV 159
34557701   81 ISILNNDPNIDGILVQLPLPKHINTAKVLEAIAPHKDVDGFHPQNVGRLTSNLGGFAPATPMGVMRLLQKYGIDPQGKNA 160
157163934  80 INVLNLDDSIHGILVQLPLPKHIDTNVVLAAIDPRKDVDGFHAVNVGKLVSGLDGFVPCTPLGVMEILKEYGIEVAGLNA 159
154174422  80 INVLNLDDSIDGILVQLPLPAHIDTTSVLETIWPQKDVDGFHAENVGKLVSGLDGFVPCTPLGIMRILKEYGIDVAGLNA 159
118475042  80 IEVLNLDDSIDGILVQLPLPKHIDTNRVLEAIDPTKDVDGFHAVNVGKLSSGLDGFVPCTPLGIMELLKEYDVNLQGIDA 159
210134778  86 IKDYNTDQNISGVLVQLPLPRHIDTKMILEAIDPNKDVDGFHPLNIGKLCTQKESFLPATPMGVMRLLEHYHIEIKGKDV 165
188527576  86 IKDYNTDQSISGVLVQLPLPRHIDTKMVLEAIDPSKDVDGFHPLNIGKLCTQKESFLPATPIGVMRLLEHYHIEIKGKDV 165
254779431  86 IKDYNTDQNISGVLVQLPLPRHIDTKMILEAIDPSKDVDGFHPLNIGKLCTQKESFLPATPMGVMRLLEHYHIGIKGKDV 165
15611591  166 AIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTKNADIVCVGVGKPDLIKASMLKKGAVVVDIGINHLNDGRIVG 245
15645202  168 AIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPDLIKASMLKKGAVVVDIGINHLNDGRIVG 247
32266865  160 VIIGMSNIVGKPLMSLMLNAGASVSCCHILTRDVKQYTKNADIVCVAVGKVGLLSADMIKEGAVVVDVGINRLESGTLVG 239
34557701  161 VIVGASNIVGKPMASLLLNANATTTLCHIYTKDLASHTQNADILCVGVGKPNLITESMVKKGAVVIDIGINRLEDGSLVG 240
157163934 160 VVIGRSNIVGKPMANLLLNASATVTVTHSKTKNLKEICKNADLIVAAIGKPFFLKADMVKDGAVVVDVGINRLDDGRLVG 239
154174422 160 VVIGRSNIVGKPMASLLLNASATVTITHSKTRNLKQICSAADLIVAAIGKPNFVTADMVKEGAIVIDVGINRLDDGRLVG 239
118475042 160 VVIGRSNIVGKPMASLLLNAGATISIAHSKTKNLPEITRRAKLVVVAVGRPNFLNADMVSDGAIVIDVGINRLDSGKLVG 239
210134778 166 AIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPDLIKASMLKKGAVVVDIGINHLNDGRIVG 245
188527576 166 AIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPDLIKASMLKKGAVVVDIGINHLNDGRIVG 245
254779431 166 AIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPDLVKASMLKKGAVVVDIGINHLNDGRIVG 245
15611591  246 DVDFINAQKIAGFITPVPKGVGPMTIVSLLENTLIAFEKQQRKGF 290
15645202  248 DVDFNNVQKVAGFITPVPKGVGPMTIVSLLENTLIAFEKQQRKGF 292
32266865  240 DVDFENVAPKSSFITPVPGGVGPMTIVSLLQNTYKAAMYRLEQRM 284
34557701  241 DVDFASVAPKCSYITPVPGGVGPMTIASLLENTLKAAKTRQETPQ 285
157163934 240 DVDFDEVAPKCSYITPVPGGVGPMTIAMLLNNTILAAQAKIAKN- 283
154174422 240 DVDFEAVAPKSSFITPVPGGVGPMTIAMLLSNTIRSAQNRAKNLG 284
118475042 240 DVDFDSVAPKCSLITPVPGGVGPMTIAMLLSNTLKSAKNRKRNV- 283
210134778 246 DVDFNNVQKVAGFITPVPKGVGPMTIVSLLENTLIAFEKQQRKGF 290
188527576 246 DVDFNNAQKVAGFITPVPKGVGPMTIVSLLENTLIAFEKQQRKGF 290
254779431 246 DVDFTNAQKVAGFITPVPKGVGPMTIVSLLENTLIAFEKQQRKGF 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap