Conserved Protein Domain Family
PRK14187

?
PRK14187: PRK14187 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172675
View PSSM: PRK14187
Aligned: 9 rows
Threshold Bit Score: 507.444
Threshold Setting Gi: 58584334
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58584334    1 MTIIIDGKKIASGLCEKLSQRIDVLKREHSIFPCLKVIFVGNNPASQVYVRNKQKKAESIGISSETIVLPDNILENELIE 80 
42520413    1 MTIIIDGKKIANDLCERLSQKIDILKREYNIFPCLKVILIGSNPASQVYVRNKQKKAESIGISSETIVLPNNILEDELIE 80 
57239400    2 EGNIVSGKAVADNITNILATCISDLKAQHNLTPCLIVVLVGDDPASQLYVRNKQRKAEMLGLRSETMLLPSTISESSLIE 81 
58617425    2 EGNIVSGKAVADNITNILATCISDLKVQHNLTPCLIVVLVGDDPASQLYVRNKQRKAEMLGLRSETMLLPSTISESSLIE 81 
58579370    2 EGNIVSGKAVADNITNILATCISDLKAQHNLTPCLIVVLVGDDPASQLYVRNKQRKAEMLGLRSETMLLPSTISESSLIE 81 
73667294    2 EANIINGKAIAEDITGTLATCINDLKLQYSLVPCLIVVLVGDDPASHLYVRNKQRKAEMLGLRSETILLPSTTSESSLID 81 
88657832    2 EENIINGKVIAEDITSTLAVCINDLKVQHNVTPCLIVILVGDDPASHLYVRNKQRKAEMLGLRSETMLLPSTTSESSLID 81 
190571146   1 MSIIINGKKTANDLCEELSKKIDILKKEYNVFPCLKVILVGSNPASQVYVRNKQRKAESIGISSETIVLPDSISEDELIE 80 
225630179   1 MTIIIDGKKIANDLCERLSQKIDILKREYNIFPCLKVILVGSNPASQVYVRNKQKKAESIGISSETIVLPDNISEDELIE 80 
58584334   81 KINELNNDRFVNGILVQLPLPNHINASKVINTVSVEKDVDAFHRENVGKLVKGEK-NCLVPCTPKGALHLIKLVETNLSG 159
42520413   81 KINELNEDPSVHGILVQLPLPNHISASRVINTVSVEKDVDGFHDENVGKLVKGEK-NCLIPCTPKGSLHLIKSIEENLSG 159
57239400   82 KIHQLNNDDSVHGILVQLPVPRHIDKNLIINTIDPKKDVDGFHNENVGRLFTGQKkNCLVPCTPQGCLYLIKTITRNLSG 161
58617425   82 KIHQLNNDDSVHGILVQLPVPRHIDKNLIINTIDPKKDVDGFHNENVGRLFTGQKkNCLVPCTPQGCLYLIKTITRNLSG 161
58579370   82 KIHQLNNDDSVHGILVQLPVPRHIDKNLIINTIDPKKDVDGFHNENVGRLFTGQKkNCLVPCTPQGCLYLIKTITRNLSG 161
73667294   82 KIHELNNDDNVHGILVQLPVPKHIDKNLIINTIDPRKDVDGFHNDNVGRLFTGQKrNCLIPCTPRGCLYLIKTVTHNLSG 161
88657832   82 TIRRLNNDDSVHGILVQLPVPKHIDKNLIINTIDPRKDVDGFHNENVGRLFTGQKkDCLIPCTPRGCLYLIKTVTRNLSG 161
190571146  81 KVNTLNEDSSVHGILVQLPLPKHISASRIINTVSVEKDVDGFHDENVGRLVKGEK-NCLIPCTPKGSLHLIKSVENNLSG 159
225630179  81 KINELNEDPSVHGILVQLPLPNHISASRVINTVSVEKDVDGFHDENVGKLVKGEK-NCLIPCTPKGSLHLIKSIEENLSG 159
58584334  160 KNAVVIGRSNIVGKPMFHLLLQENCTVTILHSQSKDLAEYCSKADVVVTAVGKPNFVQEGWIKEGAIVIDVGINSVSIEg 239
42520413  160 KNAVVIGRSNIVGKPMFYLLLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIKKGAIVIDVGINSVNVG- 238
57239400  162 SDAVVIGRSNIVGKPMACLLLGENCTVTTVHSATRDLPDYCRRADILVAAVGIPRFVKYSWVKHGAIVIDVGINSIEEDg 241
58617425  162 SDAVVIGRSNIVGKPMACLLLGENCTVTTVHSATRDLPDYCRRADILVAAVGIPRFVKYSWVKHGAIVIDVGINSIEEDg 241
58579370  162 SDAVVIGRSNIVGKPMACLLLGENCTVTTVHSATRDLPDYCRRADILVAAVGIPRFVKYSWVKHGAIVIDVGINSIEEDg 241
73667294  162 SDAVVIGRSNIVGKPMACLLLGENCTVTTVHSATRNLSDYCSKADILVAAVGIPNFVKSSWIKPGAIVIDVGINSVEEDg 241
88657832  162 SDAVVIGRSNIVGKPMACLLLGENCTVTTVHSATRNLPDYCSKADVLVAAVGIPHFVKSSWIKPGAIVIDVGINAIEEGg 241
190571146 160 KNAVIIGRSNIVGKPMFHLLLQENCTVTILHSQSRDLADYCSKADIVVAAVGKPNFVQPDWIKKGAIVIDVGINSINIGn 239
225630179 160 KNAVVIGRSNIVGKPMFYLLLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIKKGAIVIDVGINSVNVG- 238
58584334  240 ktKLIGDVDFDRVKEKTKAITPVPGGVGPMTIAFLMINTVIAACLQKKVDasDFVS 295
42520413  239 --KLVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACLQKGVDasDFIS 292
57239400  242 vkKFVGDVDFAEVNKIASAITPVPGGVGPMTIAFLMVNTIIAACNQSGID--GFLE 295
58617425  242 vkKFVGDVDFAEVNKIASAITPVPGGVGPMTIAFLMVNTIIAACNQSGIH--GFLE 295
58579370  242 vkKFVGDVDFAEVNKIASAITPVPGGVGPMTIAFLMVNTIIAACNQSGID--GFLE 295
73667294  242 vkKFVGDVNFAEAKNVASAITPVPGGVGPMTIAFLMVNTVMAACNQSGIE--NFVE 295
88657832  242 vkKFVGDVDFSEARNIASAITPVPGGVGPMTIAFLMVNTVIAACNQAGIE--NFVE 295
190571146 240 qsKLVGDVDFEGVKEKVKAITPVPGGVGPMTIAFLMINTLVAACLQKGVDpsDFIA 295
225630179 239 --KLVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACLQKGVDasNFIS 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap