Conserved Protein Domain Family
PRK14182

?
PRK14182: PRK14182 
bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Statistics
?
PSSM-Id: 172670
View PSSM: PRK14182
Aligned: 4 rows
Threshold Bit Score: 491.844
Threshold Setting Gi: 153005380
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197123021   1 MNLIDGKQIAAKVKGEVATEVRALAARGVQTGLTVVRVGDDPASAIYVRGKRKDCEEVGITSVEHHLPATTTQAELLALI 80 
220917811   1 MNLIDGKQIAAKVKGEVATEVRALAARGVQTGLTVVRVGDDPASAIYVRGKRKDCEEVGITSVEHHLPATTTQAELLALI 80 
86157673    1 MNLIDGKQIAAKVKGEVATEVRALAARGVQTGLTVVRVGDDPASAIYVRGKRKDCEEVGITSVEHHLPVTTTQAELLALI 80 
153005380   1 -MIIDGKLIAAKVRGEVAEAVRALKASGVAPGLSVVRVGDDPASAIYVRGKRKDCEEVGIRSDEHHLPATVSQADLLALV 79 
197123021  81 ARLNADPAVHGILVQLPLPKHVDERAVLDAISPAKDADGFHPFNVGALSIGIAGVPRPCTPAGVMRMLDEAKVDPKGKRA 160
220917811  81 ARLNADPAVHGILVQLPLPKHVDERAVLDAISPAKDADGFHPFNVGALSIGIAGVPRPCTPAGVMRMLDEAKVDPKGKRA 160
86157673   81 ARLNADPAVHGILVQLPLPKHVDERAVLDAISPAKDADGFHPFNVGALSIGIAGVPRPCTPAGVMRMLDEARVDPKGKRA 160
153005380  80 ARLNADPTVHGILVQLPLPKHLDERAVLDAIDPRKDSDGFHPFNVGALSIGIPGTPRPCTPAGVMRLLDEARVDPKGKRA 159
197123021 161 LVVGRSNIVGKPMAMMLLERHATVTIAHSRTADLAGEVGRADILVAAIGKAELVKGAWVKEGAVVIDVGMNRLADGKLVG 240
220917811 161 LVVGRSNIVGKPMAMMLLERHATVTLAHSRTADLAGEVGRADILVAAIGKAELVKGAWVKEGAVVIDVGMNRLADGKLVG 240
86157673  161 LVVGRSNIVGKPMAMMLLERHATVTIAHSRTADLAGEVGRADILVAAIGKAELVKGAWVKEGAVVIDVGMNRLADGKLVG 240
153005380 160 IVVGRSNIVGKPMAAMLLERHATVTIAHSRTQDLAGEVARADIVVAAIGKAELIRGEWIREGAVVIDVGMNRLDDGRLVG 239
197123021 241 DVEFAGAAARASAITPVPGGVGPMTRAMLLVNTVELAKRTAR 282
220917811 241 DVEFAAAAARASAITPVPGGVGPMTRAMLLVNTVELAKRTVR 282
86157673  241 DVEFAAAAARASAITPVPGGVGPMTRAMLLVNTVELAKRVAR 282
153005380 240 DVEYAAAARRASAITPVPGGVGPMTRAMLLVNTIELARSGAR 281
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap