Conserved Protein Domain Family
PRK14181

?
PRK14181: PRK14181 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172669
View PSSM: PRK14181
Aligned: 14 rows
Threshold Bit Score: 525.581
Threshold Setting Gi: 89898366
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
76788791    1 MLLKGAPAADHILATIKENIRACSKAPGLAVVLIGNNPASEIYVNMKIKRATDLGMVSKSYRKPSDATLSDILALIHQLN 80 
89898366    1 MLLKGTPVAERILEKLKQKISQSPTPPGLAVVLIGNDPASEVYVGMKVKKAMNLGMVSKAHRLPSDATLTDILKLIERLN 80 
62185063    1 MLLKGTPVAERVLEKIKQEISHSSTPPGLAVVLIGNDPASEVYVGMKVKKATDLGMVSKAHRLPSDATLTDILKLIERLN 80 
33241679    1 MLLRGIPAAEKILQRLKEEISQSPTSPGLAVVLIGNDPASEVYVGMKVKKATEIGIISKAHKLPSDSTLSSVLKLIERLN 80 
29840210    1 MLLKGAPVAERVLNKIKQEISNSSTRPGLAVVLIGNDPASEVYVGMKVKKATDLGMVSKAHRLSSDATLTDILKLIDRLN 80 
15618255    1 MLLRGIPAAEKILQRLKEEISQSPTSPGLAVVLIGNDPASEVYVGMKVKKATEIGIISKAHKLPSDSTLSSVLKLIERLN 80 
15835870    1 MLLRGIPAAEKILQRLKEEISQSPTSPGLAVVLIGNDPASEVYVGMKVKKATEIGIISKAHKLPSDSTLSSVLKLIERLN 80 
166154299   1 MLLKGAPAADHILATIKENIRACSKAPGLAVVLIGNNPASEIYVNMKIKRATDLGMVSKSYRKPSDATLSDILALIHQLN 80 
166155174   1 MLLKGAPAADHILATIKENIRACSKAPGLAVVLIGNNPASEIYVNMKIKRATDLGMVSKSYRKPSDATLSDILALIHQLN 80 
237802511   1 MLLKGAPAADHILATIKENIRACSKAPGLAVVLIGNNPASEIYVNMKIKRATDLGMVSKSYRKPSDATLSDILALIHQLN 80 
76788791   81 NDENIHGILVQLPLPKHLDAQAILSTITPDKDVDGLHPVNVGKLLLGETDGFIPCTPAGIVELCKYYEIPLHGKHVVILG 160
89898366   81 NDPTIHGILVQIPLPKHLDSNVIIQAISPEKDVDGLHPVNMGKLLLGQLGGFSPCTPAAVIELLNYYDIPLQGRHVAVVG 160
62185063   81 NDPTIHGILVQIPLPKHLDSHAIIQAISPEKDVDGLHPVNMGKLLLGQLGGFAPCTPAGIIELLHYYEIPLLGRHVAVVG 160
33241679   81 QDPSIHGILVQLPLPKHLDSEVILQAISPDKDVDGLHPVNMGKLLLGNFDGLLPCTPAGIIELLNYYEIPLRGRHAAIVG 160
29840210   81 NDPMIHGILVQIPLPKHLDANAVIQAISPEKDVDGLHPINMGKLLLGQLGGFAPCTPAGIIELLHYYEIPLHGRHVAVVG 160
15618255   81 QDPSIHGILVQLPLPKHLDSEVILQAISPDKDVDGLHPVNMGKLLLGNFDGLLPCTPAGIIELLNYYEIPLRGRHAAIVG 160
15835870   81 QDPSIHGILVQLPLPKHLDSEVILQAISPDKDVDGLHPVNMGKLLLGNFDGLLPCTPAGIIELLNYYEIPLRGRHAAIVG 160
166154299  81 NDENIHGILVQLPLPKHLDAQAILSTITPDKDVDGLHPVNVGKLLLGETDGFIPCTPAGIVELCKYYEIPLHGKHVVILG 160
166155174  81 NDENIHGILVQLPLPKHLDAQAILSTITPDKDVDGLHPVNVGKLLLGETDGFIPCTPAGIVELCKYYEIPLHGKHVVILG 160
237802511  81 NDENIHGILVQLPLPKHLDAQAILSTITPDKDVDGLHPVNVGKLLLGETDGFIPCTPAGIVELCKYYEIPLHGKHVVILG 160
76788791  161 RSNIVGKPLAALLMQRHADTNASVTLLHSQSEHLTEITRTADILISAIGVPLFVNKEMIAEKTVIMDVGTSRIPAANPKG 240
89898366  161 RSNIVGKPLAAMLMQKHPTTNATVTLLHSQSQNFTEILKTADIIVAAVGVPLFIQENMISPNAVIVDVGISRVATNNDKG 240
62185063  161 RSNIVGKPLAAMLMQKHPSTNATVTLLHSQSQNLKEILKTADIIIAAVGVPLFIKESMVSSHAVIIDVGTSRVATNNAKG 240
33241679  161 RSNIVGKPLAALMMQKHPQTNCTVTVLHSQSENLPEILKTADIIIAALGAPLFIKETMVAPHAVIVDVGTTRVPADNAKG 240
29840210  161 RSNIVGKPLAAMLMQKHPSTNATVTLLHSQSENLTEILKTADIIIAAVGVPLFIKETMISSHAIVVDVGTSRVAANNDKG 240
15618255  161 RSNIVGKPLAALMMQKHPQTNCTVTVLHSQSENLPEILKTADIIIAALGAPLFIKETMVAPHAVIVDVGTTRVPADNAKG 240
15835870  161 RSNIVGKPLAALMMQKHPQTNCTVTVLHSQSENLPEILKTADIIIAALGAPLFIKETMVAPHAVIVDVGTTRVPADNAKG 240
166154299 161 RSNIVGKPLAALLMQRHADTNASVTLLHSQSEHLTEITRTADILISAIGVPLFVNKEMIAEKTVIMDVGTSRIPAANPKG 240
166155174 161 RSNIVGKPLAALLMQRHADTNASVTLLHSQSEHLTEITRTADILISAIGVPLFVNKEMIAEKTVIMDVGTSRIPAANPKG 240
237802511 161 RSNIVGKPLAALLMQRHADTNASVTLLHSQSEHLTEITRTADILISAIGVPLFVNKEMIAEKTVIMDVGTSRIPAANPKG 240
76788791  241 YILVGDVDFNNVVPVCRAITPVPGGVGPMTVAMLMRNTWESFLRHTS 287
89898366  241 YMLVGDVDFNNVVTKCKAITPVPGGVGPMTVAMLMKNTWESYQKSSS 287
62185063  241 YILVGDVDFNNVVTKCKAISPVPGGVGPMTVAMLMKNTWESYQKFSS 287
33241679  241 YTLLGDVDFNNVVTKCAAITPVPGGVGPMTVAMLMSNTWRCYQNFS- 286
29840210  241 YTLVGDVDFNNVVAKCKAVSPVPGGVGPMTVAMLMKNTWESYKKSSS 287
15618255  241 YTLLGDVDFNNVVTKCAAITPVPGGVGPMTVAMLMSNTWRCYQNFS- 286
15835870  241 YTLLGDVDFNNVVTKCAAITPVPGGVGPMTVAMLMSNTWRCYQNFS- 286
166154299 241 YILVGDVDFNNVVPVCRAITPVPGGVGPMTVAMLMRNTWESFLRHTS 287
166155174 241 YILVGDVDFNNVVPVCRAITPVPGGVGPMTVAMLMRNTWESFLRHTS 287
237802511 241 YILVGDVDFNNVVPVCRAITPVPGGVGPMTVAMLMRNTWESFLRHTS 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap