Conserved Protein Domain Family
PRK14180

?
PRK14180: PRK14180 
bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Statistics
?
PSSM-Id: 172668
View PSSM: PRK14180
Aligned: 9 rows
Threshold Bit Score: 524.209
Threshold Setting Gi: 167626639
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167626639   1 MTLIDGKKLSIDLKERLTDQLREYKEQTGIVPKLVAIIVGDDPASKTYVGSKEKACEKVGINSEVITLPEATTEQELLEL 80 
187931293   1 MILIDGKSLSKDLKERLVTQVQEYKHHTAITPKLVAIIVGNDPASKTYVDSKEKACAQVGIDSQVITLPEHTTESELLEL 80 
56707993    1 MILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLEL 80 
110670464   1 MILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLEL 80 
115314297   1 MILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLEL 80 
89255805    1 MILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLEL 80 
156501785   1 MILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLEL 80 
118497024   1 MILIDGKSLSKDLKERLATQVQEYKHNTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLEL 80 
134302217   1 MILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLEL 80 
167626639  81 IDKLNDDSSVHAILVQLPLPTHINKQKVIYAIKPEKDVDGFHPANVGRLQLRDKKCLESCTPKGILTMLKEYGIQTEGAH 160
187931293  81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
56707993   81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
110670464  81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
115314297  81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
89255805   81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
156501785  81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
118497024  81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
134302217  81 IDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY 160
167626639 161 AVVVGASNVVGKPVSQLLLNAKATVTTCHRFTKDLKSHTTKADILVVAVGKPGFITADMVKDGAVVIDVGINHVDGKIVG 240
187931293 161 AVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
56707993  161 AVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
110670464 161 AVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
115314297 161 VVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
89255805  161 VVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
156501785 161 VVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
118497024 161 AVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
134302217 161 AVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVG 240
167626639 241 DVDFEAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
187931293 241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
56707993  241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
110670464 241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
115314297 241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
89255805  241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
156501785 241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
118497024 241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
134302217 241 DVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap