Conserved Protein Domain Family
PRK14178

?
PRK14178: PRK14178 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172666
View PSSM: PRK14178
Aligned: 4 rows
Threshold Bit Score: 492.436
Threshold Setting Gi: 126179777
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126179777   1 MILDGKAVSEKRLELLKEEIEESGLYPRLATVIVGEDPASQMYVRMKHRACERVGIGSIGIELPADASTEQVLEAVARLN 80 
219851399   1 MIIDGKRVSEKRLELIKEEIDESGLYPRLATVIAGDNPASLLYVQMKHRACERVHIGSISITLPGDSTTAKVLETIDRLN 80 
88601341    1 MILDGKGLAARRLELLKEDIIEGGLSPTLATVIVGDDPASHMYVRMKHRACEQVGISSVNISLPEDTTTRTILERIRQLN 80 
154151727   3 TILDGKAVSEKRLELLKETISESGLYPRLATVIVGSDPASQMYVRMKHRACERVGIGSVGIEIPGDATTQNVLESVTRLN 82 
126179777  81 NDPDINGILVQLPLPGGVDTTRVIDAVAPEKDVDGFHPCSLGRLFSGTPVFAPCTPQGIMTILDEYRIPIRGKRAVVVGR 160
219851399  81 KDPEINGILVQLPLPAGVDTEQVIEAILPEKDVDGFHPFNLGKLLGGSPTFAPCTPLGIMTLLKEYKIDPAGKRAVVIGR 160
88601341   81 EDPDIDGILVQLPLPKSIDTEAVLAAILPEKDVDGFHPLNMGRLVTGLPGPRPCTPNGIMTLLHENKISIAGKRAVVVGR 160
154151727  83 RDTDINGILIQLPLPKRVDTERVIAAVNTEKDVDGFHPTSLGLLMSGRPRFAPCTPKGIMNLLAEYHITVAGARAVVAGR 162
126179777 161 SIDVGRPMAALLLNADATVTICHSKTENLEDEMRRADILVSAIGKAKFVGPEMVKEGATVIDVGINQdEQGKLCGDVDFD 240
219851399 161 SIDVGRPMAALLINANATVTVCHSRTKDLAAELRKADIIVSAMGKARFITGDMVSGDAVVIDVGINH-VDGKLCGDVDFA 239
88601341  161 SVDVGRPIALLLLHADATVTMCHSKTENLKEITKQADILVSAAGKAGIITADMVKPGATVVDVGTNQ-VNGKLCGDVAFD 239
154151727 163 SIDVGRPMAALLTNADATVTICHSRTRDLPAELRQADILVSAVGKAHFITPEMVKPGAVVIDVGINQ-LNGKLVGDVDFE 241
126179777 241 AVKDRAGAITPVPGGVGPMTIATLMENTFRAAKLRTCGNN 280
219851399 240 SVSEKVAAITPVPGGVGPMTIATLMENTFKAAKMQSCRTV 279
88601341  240 EVEKIAGAITPVPGGVGPMTIASLMENTADIARNRCGHFM 279
154151727 242 AVKEVASAITPVPGGVGPMTIATLMENTFAAAAMRMP--- 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap