Conserved Protein Domain Family
PRK14177

?
PRK14177: PRK14177 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172665
View PSSM: PRK14177
Aligned: 6 rows
Threshold Bit Score: 578.081
Threshold Setting Gi: 189911200
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116331248   1 MDPILLDGKKLSEKIRNEIRREIEERKTKNLRIPKLATILVGNNPASETYVSMKIKACHGVGMGSEMIRLGEQTTTEELL 80 
116328520   1 MDPILLDGKKLSEKIRNEIRREIEERKTKNLRIPKLATILVGNNPASETYVSMKIKACHGVGMGSEMIRLGEQTTTEELL 80 
24214565    1 MNPVLLDGKKLSEKIKEEIRSAIEERKTKNFRIPKLATILVGNNPASETYVSMKVKACHSVGMGSEMIRLREQTTTKELL 80 
45657878    1 MNPVLLDGKKLSEKIKEEIRSAIEERKTKNFRIPKLATILVGNNPASETYVSMKVKACHSVGMGSEMIRLREQTTTKELL 80 
189911200   2 KSSILLDGKAISEKIRNRIQETLAKAKAEGKGIPTLATILVGNNPASETYVNMKVKACEKVGMHSRYIRLKEETTTEELL 81 
183221109   2 KSSILLDGKAISEKIRNRIQETLAKAKAEGKGIPTLATILVGNNPASETYVNMKVKACEKVGMHSRYIRLKEETTTEELL 81 
116331248  81 SVIDKLNADPNVDGILLQHPSPSQIDERAAFDRISFRKDVDGVTTLSFGKLSMGVETYLPCTPYGIVLLLKEHGINVSGK 160
116328520  81 SVIDKLNADPNVDGILLQHPSPSQIDERAAFDRISFRKDVDGVTTLSFGKLSMGVETYLPCTPYGIVLLLKEHGINVSGK 160
24214565   81 DVIDKLNSDPNVDGILLQHPTPSGIDERAAFDRIALHKDVDGVTTLSFGKLSMGVETYLPCTPYGMVLLLKEYGIDVAGK 160
45657878   81 DVIDKLNSDPNVDGILLQHPTPSGIDERAAFDRIALHKDVDGVTTLSFGKLSMGVETYLPCTPYGMVLLLKEYGIDVAGK 160
189911200  82 GEIRKLNLDPSINGILLQHPVPHQIDERKAFDEIALEKDVDGVTTISFGKLSMNSEAYYPCTPYGMVLLLQEYGIDVTGK 161
183221109  82 GEIRKLNLDPSINGILLQHPVPHQIDERKAFDEIALEKDVDGVTTISFGKLSMNSEAYYPCTPYGMVLLLQEYGIDVTGK 161
116331248 161 NAVVVGRSPILGKPMAMLLTEMNATVTLCHSKTQNLPEIVRLADIVVGAVGKPEFIKADWISKGAVLLDAGYNPGNVGDI 240
116328520 161 NAVVVGRSPILGKPMAMLLTEMNATVTLCHSKTQNLPEIVRLADIVVGAVGKPEFIKADWISKGAVLLDAGYNPGNVGDI 240
24214565  161 NAVVVGRSPILGKPMAMLLTEMNATVTLCHSKTQNLPDIVRNADIIIGAVGKPEFIKADWISNGAILLDAGYNPGNIGDI 240
45657878  161 NAVVVGRSPILGKPMAMLLTEMNATVTLCHSKTQNLPDIVRNADIIIGAVGKPEFIKADWISNGAILLDAGYNPGNIGDI 240
189911200 162 HAVVVGRSPILGKPMAIMLTNLNATVTLCHSKTEDLPSLVKQADIIVGAVGKPEFIKAEWMKEGVVILDAGYNVGNVGDI 241
183221109 162 HAVVVGRSPILGKPMAIMLTNLNATVTLCHSKTEDLPSLVKQADIIVGAVGKPEFIKAEWMKEGVVILDAGYNVGNVGDI 241
116331248 241 EISKAKNHSSFYTPVPGGVGPMTIAVLLLQTLYSSKEHFTPPVQ 284
116328520 241 EISKAKNHSSFYTPVPGGVGPMTIAVLLLQTLYSSKEHFTPPVQ 284
24214565  241 EISKAKDRSSFYTPVPGGVGPMTIAVLLLQTLYSAKEHFTPPVK 284
45657878  241 EISKAKDRSSFYTPVPGGVGPMTIAVLLLQTLYSAKEHFTPPVK 284
189911200 242 EVSKAKDKSSYYTPVPGGVGPMTISVLLLQTMYSFLGQFSPKLE 285
183221109 242 EVSKAKDKSSYYTPVPGGVGPMTISVLLLQTMYSFLGQFSPKLE 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap