Conserved Protein Domain Family
PRK14174

?
PRK14174: PRK14174 
bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Statistics
?
PSSM-Id: 172662
View PSSM: PRK14174
Aligned: 9 rows
Threshold Bit Score: 578.312
Threshold Setting Gi: 193214168
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78186789   13 MLIIDGKKVSLDMKEELKASVESYRSITGKVPGLTVIIVGSDPASEVYVRNKAKTCKEVGMNSSVIELQEDTPEAHLLEV 92 
78188750    1 MIVIDGKKVSLELKNELRERVEALNAKCGKVPGLTVIIVGEDPASQVYVRNKAKSCKEIGMNSTVIELPADTTQEHLLKI 80 
119356824  14 MQIIDGKKISQDLKNELKTDVAHFQASIGKVPGLTVIIVGHDPASQVYVRNKAKSCLEIGMHSTVIEMPHDTPQETLLQA 93 
145219770   1 MLIIDGKKVSLELKDELKASVDRYRETTGKVPGLTVIIVGEDPASQVYVRNKAKTCKEIGMNSSVITMPADTPEEHLLDT 80 
189500380   1 MTIIDGKQVSANLKQELKTAVEACRQKTDAVPGLTVIIVGEDPASQVYVRNKSKSCKEIGMNSTVIELPAETTEAELLAG 80 
189346631   1 MLIIDGKKVSIDLKSELKVRVDEHRAATGKVPGLTVIIVGEDPASQVYVRNKAKSCKETGMHSSVIEMDASTSEEALLSR 80 
194336300   1 MLIIDGKKVSLDLKNELKASVDNFRSITGKVPGLTVIIVGQDPASQVYVRNKAKTCKEIGMISTVIEMADDTTEKHLIET 80 
194333994   1 MMLIDGKKVSTDLKNELKTRVEELKAKAGCVPGLTVIIVGEDPASQVYVRNKAKSCKETGMNSTVIELPAETTQEELLGK 80 
193214168   1 MVVLDGKKLSQEIKAELKTKVEQYKQEIQKVPGLTVIIVGEDPASQVYVRNKAKSCNEIGMASEVIELPASTSQEELLKK 80 
78186789   93 IDSLNRDPAVHGILVQQPLPKQIDEFAVTLAIDPAKDVDGFHPENLGRLVMGHLDKCFVSCTPYGILELIGRYGIETSGK 172
78188750   81 INDLNNDDTVHGILVQQPMPKQIDEFTITLAIDPAKDVDGFHPENLGRLVMGHLDKCFVSCTPYGILELLGRYNIETKGK 160
119356824  94 IRELNQDPAVHGILVQQPLPKQIDEFAVTLAIDPSKDVDGFHPENLGRLVMGHLDKCFVSCTPYGILELLDRYNIETKGK 173
145219770  81 IASLNLDPAVHGILVQQPLPEQIDEFAVTLAIDPQKDVDGFHPENLGRLVMGHLDKCFVSCTPYGILELLGRYGIETSGK 160
189500380  81 IEALNNDNDVHGILVQQPLPAHIDDYAVTMAILPSKDVDGFHPENVGQMVLGNLDKCFISCTPYGILELFSRYSIETKGK 160
189346631  81 IRELNDDPDVHGILVQQPLPKQIDEFAVTLAIDPAKDVDGFHPENLGRLVMGHLDKCFVSCTPYGILELLGRYNIETKGK 160
194336300  81 IHKLNNDPTVHGILVQQPLPKQIDEFAVTLAIDPSKDVDGFHPENLGRLVMGHLDKCFVSCTPYGILELLGRYNIETRGK 160
194333994  81 IEALNQDPDVHGILVQQPLPSHIEEYAVTMAIDPAKDVDGFHPENVGQMVLGNLDKCFISCTPFGILELLRRYDIETRGK 160
193214168  81 IADLNHNPNVHGILVQQPLPKHIDEFAVTLAIAPEKDVDGFHPENVGRLVLGHLDKCFVSCTPFGIIEILKRYNIETKGK 160
78186789  173 HCVVIGRSNIVGKPMANLMMQKLKESNCTVTVCHSATKDIASYTRQADILIAAIGRAKFVTADMVKQGAVVIDVGINRIE 252
78188750  161 HCVVVGRSNIVGKPMANLMLQKLKESNCTVTICHSATPNITEFTKQADILIAAIGKANFITADMVKAGAVVIDVGINRVD 240
119356824 174 HCVVVGRSNIVGKPMANLMMQKLDATNCTVTVCHSATRDIPSFTKQADILIAALGKARFITADMVKPGAVVIDVGINRIE 253
145219770 161 HCVVVGRSNIVGKPMANLMLQKLKRSNCTVTICHSATQDIASYTRQADILIAAIGRAKFITPDMVKEGAVVIDVGINRID 240
189500380 161 HCVVIGRSNIVGKPMANLMLQKLKESNCTVTICHSATSNMPEITRQADIVIAAIGRPEYVTEDMIKPGAVVIDVGINRVE 240
189346631 161 HCVVVGRSNIVGKPMANLMLQKLDATNCTVTICHSATKDIPSYTRQADILIAAIGKAGFITADMVKPGAVVIDVGINRID 240
194336300 161 HCVVVGRSNIVGKPMANLMLQKLDATNCTVTICHSATKNIPFYTLQADILIAAIGKAGFITADMVKPGAVVIDVGINRIE 240
194333994 161 HCVVVGRSNIVGKPMANLMLQKLRETNCTVTVCHSATQNMPELTRQADILIAAIGRANFITREMVKPGAVVIDVGINRIE 240
193214168 161 HCVIVGRSNIVGKPMANLMVQKLAYMNCTVTVCHSATPDIATYTKQADILIAAIGKARFITGDMIKAGAVVIDVGINRIE 240
78186789  253 DPTTKSGTRLVGDVDYEGVSAKAAAMTPVPGGVGPMTIAMLLKNTLHSFERANGL 307
78188750  241 DASAKNGYRLVGDVEYAGVSALASAITPVPGGVGPMTIAMLLKNTVQSFQRVNGL 295
119356824 254 DPSTKSGYRLVGDVDYDGVAALASAITPVPGGVGPMTIAMLLKNTLQSFRRINNL 308
145219770 241 DPTTKSGTRLVGDVDYEGVSALASAMTPVPGGVGPMTIAMLLKNTLHSFERTHNL 295
189500380 241 DPSRKSGYRLVGDVDYENVNKKASAITPVPGGVGPMTIAMLLKNTLQSFMRVHNI 295
189346631 241 DPSTKSGSRLAGDVDYEGVSAIASAMTPVPGGVGPMTIAMLLKNTLQSFERANNL 295
194336300 241 DPSTKSGYRLVGDVDFEAVSTVASAMTPVPGGVGPMTIAMLLKNTLQSFQRINNL 295
194333994 241 DPSRKSGFRLAGDVDFDNVAEMASAITPVPGGVGPMTIAMLLKNTLQSFARSHNL 295
193214168 241 ATNTKSGYRLVGDVDFEAASQKASAITPVPGGVGPMTISMLLANTMKSFEHFLA- 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap