Conserved Protein Domain Family
PRK14172

?
PRK14172: PRK14172 
bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Statistics
?
PSSM-Id: 172660
View PSSM: PRK14172
Aligned: 9 rows
Threshold Bit Score: 434.594
Threshold Setting Gi: 28211245
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150016576   1 MGQIINGKEVALKVKEEIKNFVNNRKEKNLQVPKIASILVGNDGGSIYYMGSQEKVANSLGVEFLKLTLPETCNDEDVIA 80 
118444496   1 MGIKIDGKRLAQDIREELKKQVENINNNEDVKLCMANILVGNDGGSQFYVRNQNKLCHALGIKVKNINLDECIKEEELLN 80 
110803803   1 MDKILSGKTVAIDIKGQIKSYTEELKASGKSL-KISSILVGDDGGSVYYQNFQEKLANNLGIDFEKIKLDESISEENLKL 79 
110800457   1 MDKILSGKTVAIDIKGQIKNYTEELKASGKSL-KISSILVGDDGGSVYYQNFQEKLANNLGIDFEKIKLDESISEENLKL 79 
28211245    1 -----------------MKNFIDERVEKGLKVPCVSSILIGNDKGSLFYIKNQRRICKEIGIEFKNIVLEENIEEDKIIE 63 
15895353    1 MGDIINGKAESQKYKDKIIEFINERKKQGLDIPCIASITVGDDGGSLYYVNNQKKVSESLGIEFKSIFLDESIREEELIK 80 
18310805    1 MDKILSGKTVAIDIKGQIKSYTEELKASGKSL-KISSILVGDDGGSVYYQNFQEKLANNLGIDFEKIKLDESISEENLKL 79 
188587958   1 MGQIINGKEVALKIKEEIKTFVEERKNNKLRIPKIASILVGNDGGSIYYMSSQEKVANSLGVDFLKIILEENVTDDDVIN 80 
187935746   1 MGQIINGKEVALKIKEEIKTFVEERKKNKLRIPKIASILVGNDGGSIYYMSSQEKVANSLGVDFLKIILEENVTDDDVIN 80 
150016576  81 EINKLNEDNNIHGIILQLPLPNNFDEKKIIKQISPNKDIDCLTFESQGKLYMGEPKFLPCTPNSVITLIKSLNIDIVGKN 160
118444496  81 IINELNNDNEVKGIILQLPLPKHLDESKITSAIDINKDIDGLSSISVGKLYKGEKCFVPCTPRGIIELIKTCDIDIEGSN 160
110803803  80 KIEELNKDDSVNGIMLLLPLPKHIDERVVTNLIDADKDLDCLSEVSVGRFYKGEKCFMPCTPNSVITLLKAYNIEIEGKE 159
110800457  80 KIEELNKDDSVNGIMLLLPLPKHIDERAVTNLIDADKDLDCLSEVSVGRFYKGEKCFMPCTPNSVITLLKAYNIEIEGKE 159
28211245   64 VIEDLNKDENVHGIILQMPLPKTLDEEKIVNKICPSKDIDGLTDINAGRFYKGEKCFIPCTAQGIIEIIKSTKESISGKK 143
15895353   81 LIEGLNVDNKIHGIMLQLPLPNHIDAKLVTSKIDANKDIDSLTDINTGKFYKGEKSFIPCTPRSIINLIKSLNVDICGKN 160
18310805   80 KIEELNKDDSVNGIMLLLPLPKHIDERAVTNLIDADKDLDCLSEVSVGRFYKGEKCFMPCTPNSVITLLKAYNIEIEGKE 159
188587958  81 EIHKLNDDVNVQGIMLQLPLPKHLNEKKIIKEISVKKDIDCLTFESQGKLYMGEKGFLPCTPNSVVTLIKSLNVDITGKE 160
187935746  81 EIHKLNDDVNVQGIMLQLPLPKHLNEKKIIKEISVKKDIDCLTFESQGKLYMGEKGFLPCTPNSVITLIKSLKIDITGKE 160
150016576 161 VVVLGRSNIVGKPVAQLLLNENATVTICHSKTKNLREVCKNADILVVAIGRPKFIDETYVNENAIVIDVGTSSFEGKITG 240
118444496 161 AVVIGRSNIVGKPVAQLLLNENATVTICHSKTKNLKEICLNADILVSAIGKPHFITKDYVKEGAVVIDVGTSSVNGKMVG 240
110803803 160 VVIIGRSNIVGKPLFQMFLNENATVTVCHSKTKNLKEVCKRADILVVAIGRANFIDSSYVREGAVVIDVGTSEVNGKITG 239
110800457 160 VVIIGRSNIVGKPLFQMFLNENATVTVCHSRTKNLKEVCKRADILVVAIGRANFIDSSYVREGAVVIDVGTSEVNGKITG 239
28211245  144 AVVLGRSVIVGKPVAQLLVNEDATVTICHSKTKDIKSLCKEADIIVSAMGIPKFVKEDFIKDGAIVIDVGFSVLDGKMVG 223
15895353  161 AVVIGRSNIVGKPTAQLLLNENATVTICHSRTQNLKDICKKADIIVSAIGRPGFITDEFVNEKSIVIDVGTTVVDGKLRG 240
18310805  160 VVIIGRSNIVGKPLFQMFLNENATVTVCHSRTKNLKEVCKRADILVVAIGRANFIDSSYVREGAVVIDVGTSEVNGKITG 239
188587958 161 VVVLGRSNIVGKPVAQLLLNENATVTICHSKTKNLKEVCSKADILVVAIGKPKFIDEEYIKENAIVIDVGTSSFEGKITG 240
187935746 161 VVVLGRSNIVGKPVAQLLLNENATVTICHSKTKDLKEVCSKADILVVAIGKPKFIDEEYIKENAIVIDVGTSSFEGKITG 240
150016576 241 DVDFDKVIDKCRYLTPVPGGVGSLTTTLLIKNACEALQ 278
118444496 241 DVCFDEVIEKAAYVTPVPGGVGAMTTTMLIKNLCEGLK 278
110803803 240 DVNFDDVYEKASLITPVPGGVGSLTTTLLLKNVCKELD 277
110800457 240 DVNFDDVYEKASLITPVPGGVGSLTTTLLLKNVCKELD 277
28211245  224 DIDYDNVFKKAGFITPVPGGVGSVTPTMLIKNLCEVFK 261
15895353  241 DVVFDEVIKKAAYVTPVPGGVGAMTTTMLILNVCEALK 278
18310805  240 DVNFDDVYDKASLITPVPGGVGSLTTTLLLKNVCKELD 277
188587958 241 DVNFDKVIDKASFLTPVPGGVGALTTTLLIKNSCEALK 278
187935746 241 DVNFDKVIDKASFVTPVPGGVGALTTTLLIKNSCEALK 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap