Conserved Protein Domain Family
PRK14171

?
PRK14171: PRK14171 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172659
View PSSM: PRK14171
Aligned: 13 rows
Threshold Bit Score: 525.292
Threshold Setting Gi: 157827074
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157825763   1 MNNIIDGKALANEILEDLKLEIQELKSQTNASPKLAIVLVGDNPASIIYVKNKIKNAHKIGIDTLLVNLSTTIHTNDLIT 80 
229586741   1 MNNIIDGKALANEILADLKLEIQELTSQTNASPKLAIVLVGDNPASIIYVRHKIKNAHKIGIYTLLINLSATIHTNDLIS 80 
157964540   3 VNNIIDGKALANEILADLKLEIQELISQTNASPKLAIVLVGDNPASIIYVRNKIKNAHKIGIYTLLVNLSTTIHTNDLIS 82 
165933230   1 MNNIIDGKALANEILADLKLEIQELTSQTNASPKLAIVLVGDNPASIIYVRHKIKNAHKVGIYTLLINLSATIHTNDLIS 80 
15892559    1 MNNIIDGKALANEILADLKLEIQELTSQTNASPKLAIVLVGDNPASIIYVRHKIKNAHKIGIYTLLINLSATIHTNDLIS 80 
15604375   26 VNNIIDGKALANEILADLKLEIQGFKEKTKTSPKLAIVLVGDNPASMIYVKNKIKNAHQVGIDTLLVNLSTNIYTDDLIL 105
51473698    1 MNNIIDGKALANEILADLKLEIQGFKEKTQTSPKLAIVLVGDNPASMIYIKNKIKNAQQVGIDTLLVNLSTNIYTDDLIS 80 
67459091    7 VNNIIDGKALANEILADLKLEIQELKSQTNTSPKLAIVLVGDNPASIIYVKNKIKNAHKIGIDTLLVNLSTTIHTDDLIS 86 
91205798    1 MNNVIDGKALANEILSELKHEVQRLKDKTGESPKLAIVLVGDNPASIIYVKNKIKHANKIGIDTLLLNLPITIKTEDLIA 80 
157828512   1 MNNIIDGKALANEILADLKLEIQELTSQTNASPKLAIVLVGDNPASIIYVRHKIKNAHKVGIYTLLINLSATIHTNDLIS 80 
157803774   6 VNNIIDGKALANEILADLKLEIQELKDKTNTSPKLAIVLVGNNPASIIYVKHKIKNAHNIGIDTLLVNLSTNIHTDDLIL 85 
157827074   1 MNNVIDGKALANEILSELKHEVQRLKDKTGESPKLAIVLVGDNPASIIYVKNKIKHANKIGIDTLLLNLPITIKTEDLIA 80 
238650269   1 MNNIIDGKALANEILADLKLEIQELTSHTNASPKLAIVLVGDNPASIIYVRNKIKNAHKIGIYTVLINLSATIHTNDLIS 80 
157825763  81 KINELNHDNEISGMIVQLPLPNSIDKNKILSAVSPYKDVDGFHPLNVGYLHSGIidvsefSQSFIPCTALGCLAVIKKYE 160
229586741  81 KINELNLDNEISGIIVQLPLPSSIDKNKILSAVSPSKDIDGFHPLNVGYLHSGI------SQGFIPCTALGCLAAIKKYE 154
157964540  83 KINELNLDNKISGIIVQLPLPSSIDKNKILSAVSPSKDIDGFHPLNVGYLHSGI------SQNFIPCTALGCLAVIKKYE 156
165933230  81 KINELNLDNEISGIIVQLPLPSSIDKNKILSAISPSKDIDGFHPLNVGYLHSGI------SQGFIPCTALGCLAAIKKYE 154
15892559   81 KINELNLDNEISGIIVQLPLPSSIDKNKILSAVSPSKDIDGFHPLNVGYLHSGI------SQGFIPCTALGCLAAIKKYE 154
15604375  106 KINELNLDKGISGIIVQLPLPSSIDENKILSAVLPSKDSDGFHPLNVGYLHSGI------NQGFIPCTALGCLAVIKKYA 179
51473698   81 KINELNLDKEISGIIVQLPLPSSIDENKILSAVLPSKDSDGFHPLNVGYLHSGI------NQGFIPCTALGCLAVIKKYA 154
67459091   87 KINELNLDNEISGIIVQLPLPSSIDKNKILSAVSPSKDIDGFHPLNVGYLHSGI------SQGFIPCTALGCLAVIKKYE 160
91205798   81 KISELNLDQNVSGIIVQLPLPNSIDKNKILSAISPSKDVDGFHPLNVGYLHSGI------DNGFVPCTALGCLEVIKKHE 154
157828512  81 KINELNLDNEISGIIVQLPLPSSIDKNKILSAISPSKDIDGFHPLNVGYLHSGI------SQGFIPCTALGCLAAIKKYE 154
157803774  86 KINELNLNNEISGIIVQLPLPRSIDTNKILSAVLPLKDIDGFHPLNVGYLHSGI------SQGFIPCTALGCLAVIKKYE 159
157827074  81 KISELNLDQNVSGIIVQLPLPDSIDKNKILSAISPSKDVDGFHPLNVGYLHSGI------DNGFVPCTSLGCLEVIKKHE 154
238650269  81 KINELNLDNEISGIIVQLPLPSSIDKNKILSAVSPSKDIDGFHPLNVGYLHSGI------SQGFIPCTALGCLAAIKKYE 154
157825763 161 PNLSGKHVVVIGRSNIVGKPLSALLLKEDCSVTICHSKTHNLGSIALKADIVVAAIGSPLKLTAEYFNPESIVIDVGINR 240
229586741 155 PNLTGKNVVIIGRSNIVGKPLSALLLKENCSVTICHSKTHNLRSITSKADIVVAAIGSPLKLTAEYFNPKSIVIDVGINR 234
157964540 157 PNLTGKNVVIIGRSNIVGKPLSALLLKENCSVTICHSKTHNLSSITSKTDIVVAAIGSPLKLTAEYFNPESIVIDVGINR 236
165933230 155 PNLTGKNVVIIGRSNIVGKPLSALLLKENCSVTICHSKTHNLRSITSKADIVVAAIGSPLKLTAEYFNPESIVIDVGINR 234
15892559  155 PNLTGKNVVIIGRSNIVGKPLSALLLKENCSVTICHSKTHNLRSITSKADIVVAAIGSPLKLTAEYFNPKSIVIDVGINR 234
15604375  180 PNLNGKDAVIVGRSNIVGKPLSALLLQENCSVTICHSKTCNLSSITSKADIVVVAIGSPLKLTAEYFNPEAIVIDVGINR 259
51473698  155 PNLNGKDAVIVGRSNIVGKPLSALLLKENCSVTICHSKTCNLSSITSKADIVVVAIGSPLKLTAEYFNPESIVIDVGINR 234
67459091  161 PNLTGKNVVIIGRSNIVGKPLSALLLKEDCSVTICHSKSQNLSSITSKADIVVAAIGSPLKFTTEYFDPESIVIDVGINR 240
91205798  155 PNLSGKNAIIVGRSNIVGKPLSALLLKENCSVTICHSKSQNLSSITSKADIVVAAIGSPLKLTSGYFKPDAIVIDVGINR 234
157828512 155 PNLTGKNVVIIGRSNIVGKPLSALLLKENCSVTICHSKTHNLRSITSKADIVVAAIGSPLKLTAEYFNPESIVIDVGINR 234
157803774 160 TNLSGKNVVIIGRSNIVGKPLSALLLKEHCSVTICHSKSQNLSKISSKADIVIAAIGSPVKLTAEYFNPESIVIDVGINR 239
157827074 155 PNLSGKNAIIVGRSNIVGKPLSALLLKENCSVTICHSKSQNLSSITSKADIVVAAIGSPLKLTSGYFKPDAIVIDVGINR 234
238650269 155 PNLTGKNVVIIGRSNIVGKPLSALLLKENCSVTICHSKTHNLRSITSKADIVVAAIGSPLKLTAEYFNPESIVIDVGINR 234
157825763 241 ISGNKIIGDVDFEHVKSKVKYITPVPGGIGPMTIAFLLKNTVKAFKDSYSTVCH 294
229586741 235 ISSNKIIGDVDFENVQSKVQYITPVPGGIGPMTIAFLLKNTVKAFKDSLYTLDT 288
157964540 237 ISGNKIIGDVDFENVQSKVKYITPVPGGIGPMTIAFLLKNTVKAFKDSLYTLDK 290
165933230 235 ISSNKIIGDVDFENVQSKVQYITPVPGGIGPMTIAFLLKNTVKAFKDSLYTLDT 288
15892559  235 ISSNKIIGDVDFENVQSKVQYITPVPGGIGPMTIAFLLKNTVKAFKDSLYTLDT 288
15604375  260 ISHNKIAGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVKAFKNAIAL--- 310
51473698  235 ISNNKIIGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVKAFKNAIAL--- 285
67459091  241 ISGNKIIGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVKAFKDSYSTVCH 294
91205798  235 IGGNKIVGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVQAFK--IYS--- 283
157828512 235 ISSNKIIGDVDFENVQSKVQYITPVPGGIGPMTIAFLLKNTVKAFKDSLYTLDT 288
157803774 240 INGNKIIGDVDFENVKSKVKYITPVPGGIGPMTIAFLLNNTVKAFKDSYSTVCH 293
157827074 235 IGGNKIVGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVQAFK--IYS--- 283
238650269 235 ISSNKIIGDVDFENVQSKVQYITPIPGGIGPMTIAFLLKNTVKAFKDSLYTLDT 288
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap