Conserved Protein Domain Family
PRK14170

?
PRK14170: PRK14170 
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Statistics
?
PSSM-Id: 172658
View PSSM: PRK14170
Aligned: 9 rows
Threshold Bit Score: 477.26
Threshold Setting Gi: 289434641
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116872791   1 MGQIIDGEKLAKEIQERVTTEVAELAKIDKKPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPETVSEEKLLEV 80 
46907586    1 MGEIIDGKKLAKEIQEKVTREVAELVKEGKKPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPENVTEEKLLSV 80 
16803400    1 MGEIIDGKKLAKEIQEKVTREVAELVKEGKQPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPENVTEEKLLSV 80 
16800465    1 MGEIIDGKKLAKEIQEKVTSEVAELVKQGKKPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPETVTEEKLLKV 80 
217964494   1 MGEIIDGKKLAKEIQEKVTREVAELVKEGKKPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPENVTEEKLLSV 80 
226223961   1 MGEIIDGKKLAKEIQEKVTREVAELVKEGKKPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPENVTEEKLLSV 80 
289434641   1 MGQIIDGKKLAKEIQGKVTTEVAELAKNGKKPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLMELPETVSEEKLLEV 80 
284801745   1 MGEIIDGKKLAKEIQEKVTREVAELVKEGKQPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPENVTEEKLLSV 80 
284994887   1 MGEIIDGKKLAKEIQEKVTREVAELVKEGKQPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPENVTEEKLLSV 80 
116872791  81 VEELNTDDTIHGILVQLPLPKHISEEKVIDTISYDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
46907586   81 VEELNEDKTIHGILVQLPLPEHISEEKVIDTISYDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
16803400   81 VEELNEDKTIHGILVQLPLPEHISEEKVIDTISFDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
16800465   81 VEELNEDNTIHGILVQLPLPKHISEEKVIDAISFDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
217964494  81 VEELNEDKTIHGILVQLPLPEHISEEKVIDTISYDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
226223961  81 VEELNEDKTIHGILVQLPLPEHISEEKVIDTISYDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
289434641  81 VEELNTDETIHGILVQLPLPKHISEEKVIDTISYDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
284801745  81 VEELNEDKTIHGILVQLPLPEHISEEKVIDTISFDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
284994887  81 VEELNEDKTIHGILVQLPLPEHISEEKVIDTISFDKDVDGFHPVNVGNLFIGKDSFVPCTPAGIIELIKSTGTQIEGKRA 160
116872791 161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKNLPEVAKEADILVVATGLAKFVKKEYIKPGAIVIDVGMDRDENNKLCG 240
46907586  161 VVIGRSNIVGKPVAQLLLIENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENNKLCG 240
16803400  161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENNKLCG 240
16800465  161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKEYIKPGAIVIDVGMDRDENNKLCG 240
217964494 161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENNKLCG 240
226223961 161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENNKLCG 240
289434641 161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPEVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENNKLCG 240
284801745 161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENNKLCG 240
284994887 161 VVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENNKLCG 240
116872791 241 DVDFDDVIEEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
46907586  241 DVDFDDVVEEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
16803400  241 DVDFDDVVQEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
16800465  241 DVDFDDVKEQAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
217964494 241 DVDFDDVVEEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
226223961 241 DVDFDDVVEEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
289434641 241 DVDFDDVVDVAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
284801745 241 DVDFDDVVQEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
284994887 241 DVDFDDVVQEAGFITPVPGGVGPMTITMLLANTLKAAKRIWKMN 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap