Conserved Protein Domain Family
PRK14166

?
PRK14166: PRK14166 
bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Statistics
?
PSSM-Id: 172654
View PSSM: PRK14166
Aligned: 6 rows
Threshold Bit Score: 550.013
Threshold Setting Gi: 153952430
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57237696    1 MTLLDGKALSAKIKEELKEKNQFLKSKGIESCLAVILVGDDPASQTYVKSKAKACEECGIKSLVYHLNENTTQNELLALI 80 
157415122   1 MTLLDGKALSAKIKEELKEKNQFLKSKGIESCLAVILVGDNPASQTYVKSKAKACEECGIKSLVYHLNENTTQNELLALI 80 
153952430   1 MTLLDGKALSAKIKEELKEKNQFLKSKGIESCLAVILVGNNPASQTYVKSKAKACEECGIKSLVYHLNENTTQNELLALI 80 
121613160   1 MTLLDGKALSAKIKEELKEKNQFLKSKGIESCLAVILVGDNPASQTYVKSKAKACEECGIKSLVYHLNENTTQNELLALI 80 
222823592  17 MTLLDGKKLSDEIKNNLKQEVLELKTQSIEPCLAVILVGEDPASATYVGSKAKACEQCGIKSLVYRLDVNTTQNELLALI 96 
218562483   1 MTLLDGKALSAKIKEELKEKNQFLKSKGIESCLAVILVGDNPASQTYVKSKAKACEECGIKSLVYHLNENITQNELLALI 80 
57237696   81 NTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLEGKDA 160
157415122  81 NTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLEGKDA 160
153952430  81 NTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLKGKDA 160
121613160  81 NTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLEGKDA 160
222823592  97 NTLNHDDSVDGILVQLPLPAHINKDIILESINFNKDVDGFHPFNVGNLNLNLKGGFLPCTPLGVMKILEHYGIKLEGADV 176
218562483  81 NTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLEGKDA 160
57237696  161 VIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVIDVGINRLESGKIVG 240
157415122 161 VIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLESGKIVG 240
153952430 161 VIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLESGKIVG 240
121613160 161 VIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLESGKIVG 240
222823592 177 VVIGASNIVGRPMATLLLNANASVSICHIYTKDLKAYTKNADIIIVAAGCPNLLKEDMVKDGVVVIDVGINRVD-GKIVG 255
218562483 161 VIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLESGKIVG 240
57237696  241 DVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRLN 282
157415122 241 DVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRLN 282
153952430 241 DVDFEEVSKKSSYITPVPCGVGPMTIAMLLENTVKSAKNRLN 282
121613160 241 DVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRLN 282
222823592 256 DVDFENVSKKASYITPVPGGVGPMTIAMLLENTIKSAKNRIK 297
218562483 241 DVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRLN 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap