Conserved Protein Domain Family
PRK14159

?
PRK14159: PRK14159 
heat shock protein GrpE; Provisional
Statistics
?
PSSM-Id: 172647
View PSSM: PRK14159
Aligned: 6 rows
Threshold Bit Score: 228.419
Threshold Setting Gi: 222823937
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153951449   1 MSEQKQ--EFENENAENSEHLQDENLQNIEDVEQNKLQKDYDELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKD 78 
121612117   1 MSEQKQ--EFENENAENSEHLQDENLQNIEDVEQNKLQKNYDELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKD 78 
157415029   1 MSEQKQ--EFENENAENSEHLQDENLQNIEDVEQNRLQKDYDELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKD 78 
57237603    1 MSEQKQ--EIENENAQNSENLQDD-LQDNEKNETNELQKELEELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKD 77 
218562386   1 MSEQKQ--EFENENAENSEHLQDENLQNIEDVEQNKLQKDYDELKDKYMRANAEFENIKKRMEKEKLSAMAYANESFAKD 78 
222823937   1 MSEEKQngQIQEETVENSEN---------QNNELEKLQAEYNELKDTYLRANAEFENIKKRMEKEKISATIYANESFAKD 71 
153951449  79 LLDVLDALEAAINVECHDEISLKIKEGVQNTLDLFLKKLEKYGVTLIKEEKEFDPNLHEAMFHVDGENHQSGEVVTVLQK 158
121612117  79 LLDVLDALEAAINVECHDEISLKIKEGVQNTLDLFLKKLEKHGVALIKEEKEFDPNLHEAMFHVDSENHQSGEVVTVLQK 158
157415029  79 LLDVLDALEAAINVECHDEISLKIKEGVQNTLDLFLKKLEKHGVALIKEEKEFDPNLHEAMFHVDSQNHQSGEVVTVLQK 158
57237603   78 LLDVLDALEAAVNVECQDEISLKIKEGVQNTLDLFLKKLEKHGVALIKDEKEFDPNLHEAMFHVDSENHQSGEVVQVLQK 157
218562386  79 LLDVLDALEAAVNVECQDEISLKIKEGVQNTLDLFLKKLEKHGVALIKDEKEFDPNLHEAMFHVDSENHQSGEVVQVLQK 158
222823937  72 LLDVVDALEAAVNVEANDEISLKIKEGVQNTLDLLLKKLEKHMVKVIDAEGEFDPNLHEAMFHVESADHESNHIVQLLQK 151
153951449 159 GYKIADRVIRPTKVSVAK 176
121612117 159 GYKIADRVIRPTKVSVAK 176
157415029 159 GYKIADRVIRPTKVSVAK 176
57237603  158 GYKIADRVIRPTKVSVAK 175
218562386 159 GYKIADRVIRPTKVSVAK 176
222823937 152 GYMMNDRIIRSAKVSVAK 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap