Conserved Protein Domain Family
PRK14158

?
PRK14158: PRK14158 
heat shock protein GrpE; Provisional
Statistics
?
PSSM-Id: 172646
View PSSM: PRK14158
Aligned: 6 rows
Threshold Bit Score: 300.309
Threshold Setting Gi: 222054205
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222054205   1 MDKKKHSASSISEALKEKAstAEESEKQEGAESADLTETEPDKLAEMENALKAKEAEAAANWDKYLRERADLENYRKRVQ 80 
39995143    1 MDKKKHGTVQSADETIAAA--GFAGEAAQGKGEDVQSVAAEERIRQLETELAAKEAEAAANWDKFVRERADLENYRRRTQ 78 
78224716    1 MDKKKHGSHAGAHH-------TDEPAAETVAPAAEGAPAAADRVKELEEALAAKEAEAAANWDKFVRERADLENYRKRTQ 73 
197119868   1 MDKKKHDSHQH----------EKKADASQEKVEVAQPLSDADRIKELEEALAAKGLESAANWDKYLRERADLENYRKRVQ 70 
148262293   1 MEKKKHGTNSISEALKVKA--AVEQETATPEPTPQSETESADKIKQLEEALAAKEAEAAANWDKVLRERADLENYRKRVQ 78 
253702165   1 MDKKKHDSHQH----------EKKADASQEKVEVAQPVSDADRIKELEEALAAKGLESAANWDKYLRERADLENYRKRVQ 70 
222054205  81 KEKEELLKYGNESLILEILPAIDNMERALEHASEESMAAIIEGIKLTLSMLQSTLKKFGVTPVQSGPGTAFDPAFHQAMS 160
39995143   79 KEKEELLKYGNESLLQDILPVVDSMERALGHADSESLSAVIEGIRMTHGMLLGTLKKFGVVAVEAERGTVFDPAYHQAMC 158
78224716   74 KEKEELLKYGNESLIVEILPVVDNMERALDHSDDDSASAVIEGVRMTLNMLLSTLKKFGVTVVEAEKGTPFDPAVHQAMC 153
197119868  71 KEKEEILKYGKEEVIMEILPALDNLERAIDHANEES--AIVEGVRLTLSMLLSALKKFGVTPVETPQGTPFNPEFHQAMG 148
148262293  79 KEKEELLKYGNESLILEILPAIDNMERALEHACDESMSAIVEGIKMTLCMLQSTLKKFGVAPVDAGKGTTFDPAYHQAMN 158
253702165  71 KEKEEILKYGKEEIIVEILPALDNLERAIDHANEES--AIVEGVRLTLSMLLSALKKFGVTPVDTPPGTPFNPEYHQAMG 148
222054205 161 QVESAEQEPNTIVAEFQKGYLLNERLLRPALVSVAK 196
39995143  159 QVEVSELPPNTVVEVFQRGYLLNERLLRPAMVSVAT 194
78224716  154 QVENTDVPANSVVEIFQKGYLLNERLIRPAMVSVSK 189
197119868 149 QVESADQEPNTIVAVFQKGYLLNERLLRPAMVTVAV 184
148262293 159 QVESSEHEPNTIVSEFQKGYLLNERLLRPALVSVAT 194
253702165 149 QVESADQEPNTVVAVFQKGYLLNERLLRPAMVTVAV 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap