Conserved Protein Domain Family
PRK14151

?
PRK14151: PRK14151 
heat shock protein GrpE; Provisional
Statistics
?
PSSM-Id: 172640
View PSSM: PRK14151
Aligned: 21 rows
Threshold Bit Score: 243.916
Threshold Setting Gi: 192361899
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90022379   14 LLDD--DQVTLESQQAAdsGAEAPASDDvaaLQAEIARLNEELQTTKENALRAAAEAQNARRRAEQDVEKAHKFGLEKFV 91 
148549796   1 MADEqlNEKDLNVEETG-------AGNA---ADTRVLELEEQLAAAKDQALRAVADLQNVRRRAEQDVEKAHKFALEKFS 70 
170719890   1 MADEqlNEKDLNAEEAG--------AVD---NGARVQELEEQLAAAKDQSLRAVADLQNVRRRAEQDVEKAHKFALEKFA 69 
167035720   1 MADDqlNEKDLNAEEAA--------AVD---NGARVQELEEQLAAAKDQSLRVAAEAQNSIRRAEQEVDKARKFALEKFS 69 
116052909   1 MADEq-QTLDQQTPEQP-----TGAAED---LTARVQELEEQLAAAQDQALRMVADLQNVRRRAEQDVEKAHKFALEKFA 71 
104780011   1 MADEqlDEKNLNSEEAG--------AVN---GDARVQELEEQLAAAKDQSLRAAADLQNIRRRAEQDVEKAHKFALEKFA 69 
15599956    1 MADEq-QTLDQQTPEQP-----TGAAED---LTARVQELEEQLAAAQDQALRMVADLQNVRRRAEQDVEKAHKFALEKFA 71 
26991411    1 MADEqlNEKDLNVEETG-------AGNA---ADTRVLELEEQLAAAKDQALRAVADLQNVRRRAEQDVEKAHKFALEKFS 70 
218893857   1 MADEq-QTLDQQTPEQP-----TGAAED---LTARVQELEEQLAAAQDQALRMVADLQNVRRRAEQDVEKAHKFALEKFA 71 
226946322   1 MADE--QNLDNRAPEETpaAEGTSAGED---LAARVQALEEQLAAAQDQALRAAAELQNVRRRAEQDVEKAHKFALERFA 75 
90022379   92 GDILPVADNLERAIDAAKAEGADLGVVVEGVELTLKTLVDGLKRHKVEQIDPQGEPFDPQLHQAMTMIEQPDVEPNTVIN 171
148549796  71 SDLLPVIDSLELALAHSSAEDEHVKQIREGVELTLKMFQDTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSVLN 150
170719890  70 GDLLPVIDSLELALAHSSAEDEQVKKIREGVELTLKMFQDTLKRYNLEAIDPHGQPFNAEHHQAMAMQESAEVEPNSVLN 149
167035720  70 SDLLPVIDSLELALAHSSADDEHVKQIREGVELTLKMFQDTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSVLN 149
116052909  72 GDLLAVVDTLERGLEMSDPNDEAIKPMREGMELTLKMFDDTLRRYQVEALNPEGEPFNPEQHQAMAMQESASAEPGSVLK 151
104780011  70 GDLLPIIDSLERGLELSNADDDTIKPMREGIELTLKMFHDTLKRYNLEALEPHGEPFNAEHHQAMAMQESADVEPNSVLK 149
15599956   72 GDLLAVVDTLERGLEMSDPNDEAIKPMREGMELTLKMFDDTLRRYQVEALNPEGEPFNPEQHQAMAMQESASAEPGSVLK 151
26991411   71 SDLLPVIDSLELALAHSSADDEHVKQIREGVELTLKMFQDTLKRYNLEAVDPHGQPFNPEHHQAMAMQENAEVEPNSVLN 150
218893857  72 GDLLAVVDTLERGLEMSDPNDEAIKPMREGMELTLKMFDDTLRRYQVEALNPEGEPFNPEQYQAMAMQESASAEPGSVLK 151
226946322  76 QDLLGVVDSLERGIELSDPADESIRPMREGMELTLKMFHDVLRRYQLEQLDPHGEPFNPEHHQAMAMEESDSAEPGSVLK 155
90022379  172 VFQRGYTLHGRLVRPAMVVVSKA 194
148549796 151 VFQKGYLLNGRLLRPAMVVVSKA 173
170719890 150 VFQKGYLLNGRLLRPAMVVVSKA 172
167035720 150 VFQKGYLLNGRLLRPAMVVVSKA 172
116052909 152 VFQKGYLLNGRLLRPAMVVVSKA 174
104780011 150 VFQKGYLLNGRLLRPAMVVVSKS 172
15599956  152 VFQKGYLLNGRLLRPAMVVVSKA 174
26991411  151 VFQKGYLLNGRLLRPAMVVVSKA 173
218893857 152 VFQKGYLLNGRLLRPAMVVVSKA 174
226946322 156 VFQKGYLLSGRLLRPAMVVVSKA 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap