Conserved Protein Domain Family
PRK14148

?
PRK14148: PRK14148 
heat shock protein GrpE; Provisional
Statistics
?
PSSM-Id: 172637
View PSSM: PRK14148
Aligned: 9 rows
Threshold Bit Score: 298.975
Threshold Setting Gi: 167627628
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56708330    1 MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
89256511    1 MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
110670801   1 MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
115314943   1 MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
167627628   1 MGKEEKNNIEDKALDNEQ----EMDQESTSKAVEELSIEEQLERARDTIKELEETCDSFKDEALRARAEMENVRKRAERD 76 
156502622   1 MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
187931761   1 MSKQEKSNVEDKSLDIETAVQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
134301631   1 MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
118497870   1 MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERAKDTIKELEDSCDQFKDEALRAKAEMENIRKRAERD 80 
56708330   81 VSNARKFGIEKFSKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMI 160
89256511   81 VSNARKFGIEKFAKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMI 160
110670801  81 VSNARKFGIEKFSKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMI 160
115314943  81 VSNARKFGIEKFAKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTAKILVDILKKNGVEELDPKGEKFDPNLHEAMAMI 160
167627628  77 VSNARKFGIEKFAKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTSKMLVDTLKKNGLEELDPKGEKFDPNLHEAMAMI 156
156502622  81 VSNARKFGIEKFAKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMI 160
187931761  81 VSNARKFGIEKFAKELLPVIDSIGQALKHEVKHEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMI 160
134301631  81 VSNARKFGIEKFSKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMI 160
118497870  81 VSNARKFGIEKFAKELLPVIDSIEQALKHEVKLEEAIAMKEGIELTAKMLVDILKKNGVEELHPKGEKFDPNLHEAMAMI 160
56708330  161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
89256511  161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
110670801 161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
115314943 161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
167627628 157 PNSEFEDNTIFDVFQKGYMLNGRVVRAAKVVIVKN 191
156502622 161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
187931761 161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
134301631 161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
118497870 161 PNPEFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap