Conserved Protein Domain Family
PRK14146

?
PRK14146: PRK14146 
heat shock protein GrpE; Provisional
Statistics
?
PSSM-Id: 172635
View PSSM: PRK14146
Aligned: 6 rows
Threshold Bit Score: 294.333
Threshold Setting Gi: 183222724
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116330181   1 MAETSNseNKTSEEAKASEKNSRSITLEETKLENMNSEEStqtTESTQAQAAEAADSELSLQSELDAAKKEVESLKDSWA 80 
24216403    1 MAEMSN--NKTSEEAKANGKKSQSETLEESKLENMNSEES---TETTQTESMETAETETSLQTELESAKKEIESLKDSWA 75 
45656423    1 MAETSN--NKTSEEAKANEKKSQSETLEESKLENMNSEES---TETTQTESMETAETETSLQTELESAKKEIESLKDSWA 75 
116329212   1 MAETSNseNKTSEEAKASEKNSRSITLEETKLENMNSEEStqtTESTQAQAAEAADSELSLQSELDAAKKEVESLKDSWA 80 
183222724   1 MAEETN------------------QSLED---QNVQVEEGqtiSDEAIEQAVEGAE------KELDNAKKEIESLKDSWL 53 
189912756   1 MAEETN------------------QSLED---QNVQVEEGqtiSDEAIEQAVEGAE------KELDNAKKEIESLKDSWL 53 
116330181  81 RERAEFQNFKRRSAQEFVSIRKEAVKSLVSGFLNPIDNLERVGATQSPSEELKPFVEGVAMILKEFYAVLEKSNVIRFDP 160
24216403   76 RERAEFQNFKRRSAQEFVSIRKEAVKSLVSGFLNPIDNLERVGATQTNSEELKPFVDGVTMILKEFYSVLEKSNVIRFDP 155
45656423   76 RERAEFQNFKRRSAQEFVSIRKEAVKSLVSGFLNPIDNLERVGATQTNSEELKPFVDGVTMILKEFYSVLEKSNVIRFDP 155
116329212  81 RERAEFQNFKRRSAQEFVSIRKEAVKSLVSGFLNPIDNLERVGATQSPSEELKPFVEGVAMILKEFYAVLEKSNVIRFDP 160
183222724  54 RERAEFQNYKRRTANDLLNARKESIKKFAEGLTGALDNLERVSNVPNQTPEVVAFVEGIKMVQKEFYSVLEKEGIKRLDP 133
189912756  54 RERAEFQNYKRRTANDLLNARKESIKKFAEGLTGALDNLERVSNVPNQTPEVVAFVEGIKMVQKEFYSVLEKEGIKRLDP 133
116330181 161 KGESFDPMSMEALSSEEGDQYSEETVIDVYQAGYYYKENEDKFTLRPARVRIGKPKS 217
24216403  156 KGEPFDPMSMEALSSEEGDQYSEETVIDVYQPGYYYKENEDKFTLRPARVRIGKPKS 212
45656423  156 KGEPFDPMSMEALSSEEGDQYSEETVIDVYQPGYYYKENEDKFTLRPARVRIGKPKS 212
116329212 161 KGESFDPMSMEALSSEEGDQYSEETVIDVYQAGYYYKENEDKFTLRPARVRIGKPKS 217
183222724 134 KGQPFDPMLMEAIASEESAEFTEETVVETYQAGYYHEEGESKQSIRPARVKVGKPQS 190
189912756 134 KGQPFDPMLMEAIASEESAEFTEETVVETYQAGYYHEEGESKQSIRPARVKVGKPQS 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap