Conserved Protein Domain Family
PRK14141

?
PRK14141: PRK14141 
heat shock protein GrpE; Provisional
Statistics
?
PSSM-Id: 172630
View PSSM: PRK14141
Aligned: 40 rows
Threshold Bit Score: 320.849
Threshold Setting Gi: 27375787
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161618159   1 MADEKNKPENPDLDQRDINNPRDREAlkqaaddflkarraearaeaaaDEAEGEVDETANRIAVLEADNTELKDQMLRVA 80 
148251806   1 MTDPDLHKNDPENPAQASEPVVS-------------------------KPYIMPDDPETGSAEALAKEAADARDKMLRTL 55 
146337339   1 MTDPDLHQNDPENPAQASEPVVS-------------------------KPYIMPDDPETGSAEAYAKEAAEARDKMLRTL 55 
75674394    1 MTDSDGKTDKSGEPAAEVEPVVS-------------------------KPYVMPDDPEDDALDALNKQLAEAKDRTLRTL 55 
86747553    1 MTDSNGPKDNNQDQAQAAADPVVS------------------------KPYIMPDDPEDGANEALIKEAAEARDKMLRTL 56 
90421851    2 MTDPNGPKDTPAQPAQAAEPVVS-------------------------KPYIMPDDPEVGSTEALAKEAAESRDKMLRTL 56 
91974873    1 MTDSNGQKDNNQDQAQPADPVVS-------------------------KPYIMPDDPEEGTNEALVREAAEARDKMLRTL 55 
92115785    7 MTDSDGKSDNSGDPAPEAEPVVS-------------------------KPYIMPDDPEEGSLEALAKEVAEAKDRMLRTL 61 
115522379   1 MTDPNGPKDIPEQSAEAAEPVVS-------------------------KPYIMPDDPEPDAVELLAKEAAEARDKMLRTL 55 
209883569   1 MTDNDGQKDFSEAAAENAGSKPGEPRv--------------------sKPYIMPDDPEETPSEALVKEAAEAKDRMLRTL 60 
161618159  81 AEMENLRKRTQRDVQDARAYAITNFARDMLSVSDNLRRALDAIPADALE-ADSNLKSLSEGVEMTERAMLLALERHGVKK 159
148251806  56 AEMENLRKRTAREVADARIYGITGFARDVLDIADNLQRALDAVPAETRAnADPGLKALIEGVELTERSLLNTLEKNGVKK 135
146337339  56 AEMENLRKRTAREVADARMYGITGFARDVLDIADNLQRALDAVPAETRAnADAGLKSLIEGVELTERSLLNTLEKNGVKK 135
75674394   56 AEMENLRKRTAREVSDARTYGISGFARDVLEIADNLQRALDAVPADARAaPDPGLKALIEGVELTERSLHNALEKHGVKK 135
86747553   57 AEMENLRRRTQKEVADARTYGVSAFARDVLEIADNLQRALDAVPAEARAnADAGLKGLIEGVELTERSLINALEKNGVRK 136
90421851   57 AEMENLRKRTAREVADARTYGIAGFARDVLDIADNLQRALDAVPADARAtAEPGLKALIEGVELTERSMLNALEKNGVKK 136
91974873   56 AEMENLRRRTAKEVADARTYGVSAFARDVLEIADNLQRALDAVPAEARAnADAGLKGLIEGVELTERSLINALEKNGVKK 135
92115785   62 AEMENLRKRTAREVSDARTYGISGFARDVLDIADNLQRALDAVPTEARAaADPGLKALIEGVELTERSLHNALEKHGVKK 141
115522379  56 AEMENLRKRTTREVADARIYGVTAFARDVLEIADNLQRALDAVPAEARAnAEPGLKALIDGVELTERSLINALEKNGVKK 135
209883569  61 AEMENLRKRTQREVADARAYGIAGFARDVLEIADNLQRALDAVPAEARAaADPGLTALIEGVELTERSLHRALEKNGVKK 140
161618159 160 LEPEGQKFDPNFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSA-ENGASTSEDNA 230
148251806 136 FDPTGQKFDPNFQQAMYEVPDASVPSGTVVQVVQAGFMIGERVLRPALVGVSKGGAKPAP-AANNDQPNNAA 206
146337339 136 FDPTGQKFDPNFQQAMYEVPDPSVPSGTVVQVVQAGFMIGERVLRPALVGVSKGGAKAAPaAS-NDQSNSAA 206
75674394  136 FDPAGEKFDPNVHQAMYEVPDPSIPVGTVAQVIQAGYMIGERVLRPALVGVAKGGAKAAApE---------- 197
86747553  137 FDPSGEKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFMIGERVLRPALVGVAKGGAKPAP-AATNGTDTTA- 206
90421851  137 FDPIGEKFDPNFQQAMYEVPDSSVAAGTVVQVVQAGFTLGDRVLRPALVAVSKGGAKANSsANDSASSD--- 205
91974873  136 FDPQGEKFDPNFQQAMYEVPDPSVPAGTVVQVVQAGFMIGERVLRPALVGVSKGGAKPAP-AAANGNEGGVA 206
92115785  142 FDPAGEKFDPNVHQAMYEIPDPSVPVGTIAQVIQAGYTIGERVLRPALVGVAKGGAKAAAsE---------- 203
115522379 136 FDPSGQKFDPNFQQAMYEVPDASVPAGTVVQVVQAGFMLGERVLRPALVGVSKGGAKAAPaAAANGESNSAA 207
209883569 141 LDAAGEKFDPNIHQAMFEVPDNSVPPGTVVQVIQTGYMIGDRVLRPALVGVSKAEPKPAA------------ 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap