Conserved Protein Domain Family
PRK14138

?
PRK14138: PRK14138 
NAD-dependent deacetylase; Provisional
Statistics
?
PSSM-Id: 172627
View PSSM: PRK14138
Aligned: 7 rows
Threshold Bit Score: 421.924
Threshold Setting Gi: 239617254
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15643256    3 MKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPNGIYKKYSQNVFDIDFFYSHPEEFYRFAKEGIFPMLQAKPNLAHVL 82 
148269570   1 MKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPNGIYKKYSQNVFDIDFFYSHPEEFYQFAKEGIFPMLEAKPNLAHVL 80 
170288246   1 MKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPNGIYKKYSQNVFDIDFFYSHPEEFYQFAKEGIFPMLEAKPNLAHVL 80 
157364880   1 -MNLIELLKSCRYGVALTGAGISTPSGIPDFRSPTGLYSKYPENVFDIDYLYNNPEGFYRFCKEALIPMADAKPNVAHYL 79 
222099155   1 MKEFLKLLNESRLTVVLTGAGISTPSGIPDFRGPQGIYRKYPQNVFDIDFFYSHPEKFYEFAKEGIFPMLEAKPNPAHVL 80 
239617254   7 AEEFLEFLDESESTAILTGAGVSTASGIPDFRGPQGLYKKLPQYIFDLDFFLSQPAEYYKIAADRIHNLFNKEPNATHRL 86 
281411711   1 MKEFLKLLNESRLTVVLTGAGISTPSGIPDFRGPQGIYRKYPQNVFDIDFFYSHPEKFYEFAKEGIFPMLEAKPNPAHVL 80 
15643256   83 LAKLEEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVEEYYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIVFF 162
148269570  81 LAKLEEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVEEYYCVRCEKKYTVEDVIEKLESLDVPRCDDCNGLIRPNIVFF 160
170288246  81 LAKLEEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVEEYYCVRCEKKYTVEDVIEKLESLDVPRCDDCNGLIRPNIVFF 160
157364880  80 LAKLEQKGYIKAVITQNIDGLHQKAGNQNIIELHGSIYNYYCIKCLKRYTIDDVKNMLSKTSVPKC-SCSGMIRPDIVFF 158
222099155  81 LAKLEERGLIEAVITQNIDRLHQKAGSKKVIELHGNVEEYYCTRCGKEYTVKDVMEKLEKDSVPRCDDCSGLIRPNIVFF 160
239617254  87 LAMLEKKGMIEGVITQNIDGLHQKAGSKKVIELHGNAQKFFCMSCGKRYTAEDVLKMLEVSDVPKC-TCGGLIKPDVVFF 165
281411711  81 LAKLEERGLIETVITQNIDRLHQKAGSKKVIELHGNVEEYYCTRCGKEYTVKDVMEKLEKDSVPRCDDCSGLIRPNIVFF 160
15643256  163 GENLPQDALREAIGLSSRASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEE 242
148269570 161 GENLPQDALREAIELSSKASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEE 240
170288246 161 GENLPQDALREAIELSSKASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEE 240
157364880 159 GEQLPQKALSEAEYHSINCDLMIVFGSSLLVYPAAQFPYIAKMNGSKLIIVNSGRTGLDHICDLKIEKELSTFANEFFSS 238
222099155 161 GEALPQNALNEAIRLSSKANLMIVMGSSLVVYPAAELPLITVRGGGKLVIVNMGETPLDDLATLKYNMDVVEFANNVMKE 240
239617254 166 GEALPESAMAEAYILSENAELFITMGSSLVVYPAAHLPTFAKQKGAKLLIINQGETGLDYIADKKYECDLAEFSERIISL 245
281411711 161 GEALPQNALNEAIRLSSKANLMIVMGSSLVVYPAAELPLITVRGGGKLVIVNMGETPLDDLATLKYNMDVVEFANNVMKE 240
15643256  243 GG--IS 246
148269570 241 GG--IS 244
170288246 241 GG--IS 244
157364880 239 GSdfLN 244
222099155 241 GG--IS 244
239617254 246 LG--EV 249
281411711 241 GG--IS 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap