Conserved Protein Domain Family
recX

?
PRK14137: recX 
recombination regulator RecX; Provisional
Statistics
?
PSSM-Id: 172626
View PSSM: PRK14137
Aligned: 3 rows
Threshold Bit Score: 226.399
Threshold Setting Gi: 226356165
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226356165   1 MYRARRRARTPGegeapgtdTGHPVRPERRTPPTPDEAREALMAYALRALAARAMTASELRAKLERRSEDEALVTAVLER 80 
15806328   23 MYRPRRRSSTPA--------SEGEAEPRPRRPKTREEQREALLAYAFRALGARAITEAELRGKLERRSEDPELVEEVLRR 94 
94985533    1 ---MGNLKSVAGhrgpckrhTEGVNTPQR---SGKQQARDDLLAYAFRALAGRALTAAELRTRLLRRTDDETLAAEVLAR 74 
226356165  81 VRELGYQDDTQVARAENSRRGIGAFRVRQTLKRRGVEETLIEDTVAARDPQAEAQEIRNLLERRWSSFARKKDAAASAYA 160
15806328   95 VQELGYQNDAEVARAENKRRGVGELRVRQTLRRRGLGADLIEETLQARDPEEEQQQAIDLLTKRWPALSRKRDPRASAYA 174
94985533   75 VQELGYQSDAVVARAEGTRRGVGGLRVRQTLRRRGVTEGLIEETLAARDTAEEQAAAVALLARRWSSFTRKRDPRASAYA 154
226356165 161 FLARRGYSGALIWPAIREQQAQagldvsdVPEEES 195
15806328  175 FLARRGFGGSVIWPAIREVAEL-------FPPDEA 202
94985533  155 YLARRGFSGAVIWAALDEVAHLegkpdgaGLDDGD 189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap